DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and Yeats4

DIOPT Version :10

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_001120999.1 Gene:Yeats4 / 299810 RGDID:1305741 Length:227 Species:Rattus norvegicus


Alignment Length:175 Identity:47/175 - (26%)
Similarity:78/175 - (44%) Gaps:33/175 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GHTSKLRSKKTPHPQAFTHDWEIYVQGVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQES 74
            |:.::...||. .....||.|.:||:.....|:||:|:|:.|.||||:..|.|||.:|||.|.|:
  Rat    28 GNVARYFGKKR-EEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITET 91

  Fly    75 GYAGFLLPVEIYFRNRDEPKRIVYQYDLVLQS---------TGPPQHHVEVKTHIFEAPSEEFRT 130
            |:..|.:.::|:|.:.:|....:|....:.||         |...:.:.|:   ||:.|:...:.
  Rat    92 GWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEM---IFQDPTAMMQQ 153

  Fly   131 KLMRGGGVPVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAK 175
            .|                    |.|..:..|...|..|.:.::.|
  Rat   154 LL--------------------TTSRQLTLGAYKHETEFAELEVK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS_AF-9_like 5..134 CDD:341125 41/132 (31%)
AHD 867..927 CDD:436050
Yeats4NP_001120999.1 YEATS_GAS41_like 19..155 CDD:341128 40/130 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.