DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and tfg3

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_593114.1 Gene:tfg3 / 2541729 PomBaseID:SPAC22H12.02 Length:241 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:42/198 - (21%)
Similarity:78/198 - (39%) Gaps:45/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GHTSKLRSKKTPHPQAFTHDWEIYVQGVN----KADISAFVEKVVFVLHESFPKPKRVVKEPPYA 70
            |..:.|..:..|     ..:|.|.:..:|    :.|.| ||::|.:.||.:|..|.|.:::||:.
pombe    20 GEAAVLNDQSFP-----VREWSIKLVCLNPQGEETDAS-FVDRVTYKLHPTFQNPTRTIRKPPFQ 78

  Fly    71 IQESGYAGFLLPVEIYFRNRDEPKRIVYQYDLVLQSTGPPQHHVEVKTHIFEAPSEEFRTKLMRG 135
            |:|.|:..|.:.:.||:.::....|.::......:     .:|.:::.:| .|........|...
pombe    79 IKEQGWGEFEMEIIIYYADKGGEHRFLHYLHFQQE-----HYHEDIELNI-NATRPGLLKALTAT 137

  Fly   136 GGVPVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNSDLNTGKKH-KSRSED 199
            |.||.:.                ..||.|..::...            .|::..|||. |::..|
pombe   138 GEVPGYS----------------DEGEEARKDKRKN------------ESEVGAGKKKAKAKPVD 174

  Fly   200 PGK 202
            ..|
pombe   175 MDK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 22/83 (27%)
tfg3NP_593114.1 TFG3 1..238 CDD:227366 42/198 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.