DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ear and Y105E8B.7

DIOPT Version :9

Sequence 1:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster
Sequence 2:NP_493542.2 Gene:Y105E8B.7 / 190914 WormBaseID:WBGene00013692 Length:269 Species:Caenorhabditis elegans


Alignment Length:213 Identity:58/213 - (27%)
Similarity:93/213 - (43%) Gaps:41/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VQFEIGHTSKLRSKKTP--HPQAFTHDWEIYVQGVNKADISAF-----VEKVVFVLHESFPKPKR 62
            |:..:||:    |.:.|  :....||.|.::|:..|: |...|     ::||.|.:||||.:|.|
 Worm     4 VEVIVGHS----STRLPENNENGHTHKWTLFVKPGNR-DYDEFPDNKLIQKVKFEIHESFAQPVR 63

  Fly    63 VVKEPPYAIQESGYAGFLLPVEIYFR-NRDEPKRIVYQ--------------YDLVLQSTGPPQH 112
            .|.:||:.|.|:|:|.|...|.|:.. ..::|:.|.|:              ..||:|...||.:
 Worm    64 FVTKPPFKITETGFASFTTLVTIFLNLPNEKPRTIPYELTLFTGDQDVQLETQKLVVQKDVPPAY 128

  Fly   113 HVEVKTHIFEAPSEEFRTKLMRGGGVPVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGV 177
            ...:|.:.        |||..:...:     :....|.:|.:.......|...|.:||..|.|||
 Worm   129 LELIKKYA--------RTKKRKASLI-----SNDEKSPSRKMHKITPVKEEESSQKMSKSKEKGV 180

  Fly   178 P-GTISMNSDLNTGKKHK 194
            | ..|.:..:..:.||.|
 Worm   181 PIPKIDIEIEKASPKKEK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
earNP_001262595.1 YEATS 27..107 CDD:281374 32/99 (32%)
Y105E8B.7NP_493542.2 YEATS 24..105 CDD:281374 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.