DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and yddK

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:YP_009518781.1 Gene:yddK / 947312 ECOCYCID:G6772 Length:318 Species:Escherichia coli


Alignment Length:307 Identity:76/307 - (24%)
Similarity:147/307 - (47%) Gaps:35/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LH---RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIP-DDI------KHLQSLQVADF 113
            ||   |::.:.|:||.|..|  :.:|...|..|::|.|::  :| :||      |||..:.|...
E. coli     7 LHNHPRMKTITLNDNHIAHL--NAKNTTKLEYLNLSNNNL--LPTNDIDQLISSKHLWHVLVNGI 67

  Fly   114 SSNPIPKLPSGFSQLKNL------TVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETIS 172
            :::|:.:: ..::.::|:      ..:.|:.::|||.|....:.|   |:.|..|...|...|  
E. coli    68 NNDPLAQM-QYWTAVRNIIDDTNEVTIDLSGLNLTTQPPGLQNFT---SINLDNNQFTHFDAT-- 126

  Fly   173 QLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELP 237
            ...:|.:|.|..|.:|.:....|....:..:.:::|.|:.:  ::..|:.:||...:.|:||.: 
E. coli   127 NYDRLVKLSLNSNALESINFPQGRNVSITHISMNNNALRNI--DIDRLSSVTYFSAAHNQLEFV- 188

  Fly   238 NEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFL 302
             ::.....|..|:|:.|.|..:..|  ..:.|.:|.|..|:|..|::.|  ..|:..|::..|.|
E. coli   189 -QLESCEWLQYLNLSHNQLTDIVAG--NKNELLLLDLSHNKLTSLHNDL--FPNLNTLLINNNLL 248

  Fly   303 SELPASIGQMTKLNNLNVDRNALEYLPLE-IGQCANLGVLSLRDNKL 348
            ||:.........:..||...|.|:|:.|: :....::..|.|.:||:
E. coli   249 SEIKIFYSNFCNVQTLNAANNQLKYINLDFLTYLPSIKSLRLDNNKI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 58/239 (24%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566 13/38 (34%)
leucine-rich repeat 39..61 CDD:275380 2/4 (50%)
leucine-rich repeat 62..84 CDD:275380 6/21 (29%)
LRR_8 84..138 CDD:290566 14/66 (21%)
leucine-rich repeat 85..107 CDD:275380 10/28 (36%)
leucine-rich repeat 108..130 CDD:275380 2/21 (10%)
LRR_8 129..187 CDD:290566 16/63 (25%)
leucine-rich repeat 131..153 CDD:275380 5/27 (19%)
leucine-rich repeat 154..176 CDD:275380 5/21 (24%)
leucine-rich repeat 177..199 CDD:275380 6/21 (29%)
LRR_8 198..256 CDD:290566 12/57 (21%)
leucine-rich repeat 200..222 CDD:275380 3/21 (14%)
leucine-rich repeat 223..245 CDD:275380 5/21 (24%)
LRR_8 267..325 CDD:290566 16/57 (28%)
leucine-rich repeat 269..289 CDD:275380 7/19 (37%)
leucine-rich repeat 292..314 CDD:275380 5/21 (24%)
leucine-rich repeat 315..337 CDD:275380 6/22 (27%)
LRR_4 337..375 CDD:289563 4/12 (33%)
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
yddKYP_009518781.1 leucine-rich repeat 13..33 CDD:275380 6/21 (29%)
LRR 93..>318 CDD:227223 54/216 (25%)
leucine-rich repeat 110..130 CDD:275380 6/24 (25%)
leucine-rich repeat 131..153 CDD:275380 6/21 (29%)
leucine-rich repeat 154..174 CDD:275380 3/21 (14%)
leucine-rich repeat 175..195 CDD:275380 5/21 (24%)
leucine-rich repeat 196..216 CDD:275380 6/21 (29%)
leucine-rich repeat 217..240 CDD:275380 8/24 (33%)
leucine-rich repeat 241..260 CDD:275380 5/18 (28%)
leucine-rich repeat 261..284 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.