DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and PIRL3

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_563921.1 Gene:PIRL3 / 837855 AraportID:AT1G12970 Length:464 Species:Arabidopsis thaliana


Alignment Length:273 Identity:87/273 - (31%)
Similarity:125/273 - (45%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFS 126
            :.::.|||:|:..||..:.....||.|:||||::..:||.|..|:.|:..|.|||.:..||....
plant   163 VERIDLSDHELKLLPDALGKIVGLVSLNVSRNNLRFLPDTISGLEKLEELDLSSNRLVFLPDSIG 227

  Fly   127 QLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLP 191
            .|.||.:|.:....||.                       |||:|:|...|..||...|.:..||
plant   228 LLLNLRILNVTGNKLTL-----------------------LPESIAQCRSLVELDASFNNLTSLP 269

  Fly   192 PYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLL 256
            ...||                     ||| .|..|.:..|::...||.|..:.||..||...|.:
plant   270 ANFGY---------------------GLL-NLERLSIQLNKIRFFPNSICEMRSLRYLDAHMNEI 312

  Fly   257 EALPDGIAKLSRLTILKLDQN--RLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLN 319
            ..||..|.:|:.|.::.|..|  .|..|.||:.:..|::||.|:.|.:..||.|..::.||..||
plant   313 HGLPIAIGRLTNLEVMNLSSNFSDLIELPDTISDLANLRELDLSNNQIRVLPDSFFRLEKLEKLN 377

  Fly   320 VDRNALEYLPLEI 332
            :|:|.|||.|.|:
plant   378 LDQNPLEYPPQEM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 65/222 (29%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566 13/32 (41%)
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380 6/21 (29%)
LRR_8 84..138 CDD:290566 22/53 (42%)
leucine-rich repeat 85..107 CDD:275380 11/21 (52%)
leucine-rich repeat 108..130 CDD:275380 8/21 (38%)
LRR_8 129..187 CDD:290566 14/57 (25%)
leucine-rich repeat 131..153 CDD:275380 4/21 (19%)
leucine-rich repeat 154..176 CDD:275380 5/21 (24%)
leucine-rich repeat 177..199 CDD:275380 8/21 (38%)
LRR_8 198..256 CDD:290566 14/57 (25%)
leucine-rich repeat 200..222 CDD:275380 3/21 (14%)
leucine-rich repeat 223..245 CDD:275380 6/21 (29%)
LRR_8 267..325 CDD:290566 21/59 (36%)
leucine-rich repeat 269..289 CDD:275380 7/21 (33%)
leucine-rich repeat 292..314 CDD:275380 7/21 (33%)
leucine-rich repeat 315..337 CDD:275380 10/18 (56%)
LRR_4 337..375 CDD:289563
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
PIRL3NP_563921.1 leucine-rich repeat 163..185 CDD:275380 6/21 (29%)
LRR <185..385 CDD:227223 77/244 (32%)
leucine-rich repeat 186..208 CDD:275380 11/21 (52%)
leucine-rich repeat 209..231 CDD:275380 8/21 (38%)
leucine-rich repeat 232..254 CDD:275380 9/44 (20%)
leucine-rich repeat 255..278 CDD:275380 11/44 (25%)
leucine-rich repeat 279..301 CDD:275380 6/21 (29%)
leucine-rich repeat 302..324 CDD:275380 8/21 (38%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
leucine-rich repeat 350..372 CDD:275380 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.