DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and AT5G17680

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001331467.1 Gene:AT5G17680 / 831634 AraportID:AT5G17680 Length:1295 Species:Arabidopsis thaliana


Alignment Length:474 Identity:120/474 - (25%)
Similarity:217/474 - (45%) Gaps:85/474 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RQVEFVDKRHC-SLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRKLGLSD-NEIGRL 75
            :.:|.|....| ||...||    .|.....|:|.:..|.:||.:..||..|.||.:|| ..:..|
plant   696 KSLETVGMSGCSSLKHFPE----ISWNTRRLYLSSTKIEELPSSISRLSCLVKLDMSDCQRLRTL 756

  Fly    76 PPDIQNFENL--VELDVSRNDIPDIPDDIKHLQSLQVADFSS----NPIPKLPSGFSQLKNLTVL 134
            |..:.:..:|  :.||..|. :.::||.:::|.||:..:.|.    |..|::.:      ::.||
plant   757 PSYLGHLVSLKSLNLDGCRR-LENLPDTLQNLTSLETLEVSGCLNVNEFPRVST------SIEVL 814

  Fly   135 GLNDMSLTTLPADFGSLTQLESLELREN-LLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLP 198
            .:::.|:..:||...:|:||.||::.|| .|..||.:||:|..|::|.|....:           
plant   815 RISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSGCSV----------- 868

  Fly   199 GLHELWLDHNQLQRLPPEL-GLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDG 262
                       |:..|.|: ..::.|.:.|:....::|||..|..||:|..|..::.::...|..
plant   869 -----------LESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWS 922

  Fly   263 IAKLSRLTILKL------DQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVD 321
            ||:|:||.:|.:      .:..|..|...|...::::.|.|:...::|:|.|||.:..|..|::.
plant   923 IARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTEIPNSIGNLWNLLELDLS 987

  Fly   322 RNALEYLPLEIGQCANLGVLSLRD-NKLKKLPPEL---------GNCTVLHVLDVSG--NQLLYL 374
            .|..|::|..|.:...|..|:|.: .:|:.||.||         .:||.|  :.:||  ||    
plant   988 GNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSL--VSISGCFNQ---- 1046

  Fly   375 PYSLVNLQLKAVWLSENQSQPLL-------TFQPDTDAETGEQVLSCYLLPQQEYQPITPARDLE 432
             |.|..|.....:..:..:|.|:       :.:|:.....|..:.:|:     .:|.:.|:.:::
plant  1047 -YCLRKLVASNCYKLDQAAQILIHRNLKLESAKPEHSYFPGSDIPTCF-----NHQVMGPSLNIQ 1105

  Fly   433 SDSEPFEEREPSRTVVKFS 451
                 ..:.|.|..::.||
plant  1106 -----LPQSESSSDILGFS 1119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 76/285 (27%)
leucine-rich repeat 18..38 CDD:275380 7/20 (35%)
LRR_8 37..95 CDD:290566 18/60 (30%)
leucine-rich repeat 39..61 CDD:275380 7/21 (33%)
leucine-rich repeat 62..84 CDD:275380 7/22 (32%)
LRR_8 84..138 CDD:290566 14/59 (24%)
leucine-rich repeat 85..107 CDD:275380 7/23 (30%)
leucine-rich repeat 108..130 CDD:275380 4/25 (16%)
LRR_8 129..187 CDD:290566 21/58 (36%)
leucine-rich repeat 131..153 CDD:275380 6/21 (29%)
leucine-rich repeat 154..176 CDD:275380 11/22 (50%)
leucine-rich repeat 177..199 CDD:275380 3/21 (14%)
LRR_8 198..256 CDD:290566 13/58 (22%)
leucine-rich repeat 200..222 CDD:275380 3/22 (14%)
leucine-rich repeat 223..245 CDD:275380 7/21 (33%)
LRR_8 267..325 CDD:290566 16/63 (25%)
leucine-rich repeat 269..289 CDD:275380 5/25 (20%)
leucine-rich repeat 292..314 CDD:275380 7/21 (33%)
leucine-rich repeat 315..337 CDD:275380 6/21 (29%)
LRR_4 337..375 CDD:289563 15/49 (31%)
leucine-rich repeat 361..382 CDD:275380 7/22 (32%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
AT5G17680NP_001331467.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.