DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and PIRL4

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_195272.1 Gene:PIRL4 / 829699 AraportID:AT4G35470 Length:549 Species:Arabidopsis thaliana


Alignment Length:262 Identity:95/262 - (36%)
Similarity:142/262 - (54%) Gaps:2/262 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDM 139
            ||..:....:|..||:|.|.|..:|:.|..|.||...|..||.|.:||....:|.||..|.|...
plant   238 LPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVYLNLGSN 302

  Fly   140 SLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELW 204
            .|::||:.|..|.:||.|:|..|.|..|||:|..|..||:||:..|:||::|..:|....|.||.
plant   303 QLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCSSLIELR 367

  Fly   205 LDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRL 269
            .|:|:|:.||..:|.:|.|..|.|..|.:.:||..:|.|.||.:||::.|.||::|:.:...:.|
plant   368 ADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESLCFATTL 432

  Fly   270 TILKLDQN--RLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEI 332
            ..|.:..|  .:..|..::||.|.::||.::.|.:..||.|...:|||.......|.|...|.:|
plant   433 VKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLHIPPRDI 497

  Fly   333 GQ 334
            .:
plant   498 AE 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 78/209 (37%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566 7/19 (37%)
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380 2/8 (25%)
LRR_8 84..138 CDD:290566 22/53 (42%)
leucine-rich repeat 85..107 CDD:275380 9/21 (43%)
leucine-rich repeat 108..130 CDD:275380 8/21 (38%)
LRR_8 129..187 CDD:290566 25/57 (44%)
leucine-rich repeat 131..153 CDD:275380 8/21 (38%)
leucine-rich repeat 154..176 CDD:275380 11/21 (52%)
leucine-rich repeat 177..199 CDD:275380 9/21 (43%)
LRR_8 198..256 CDD:290566 23/57 (40%)
leucine-rich repeat 200..222 CDD:275380 9/21 (43%)
leucine-rich repeat 223..245 CDD:275380 8/21 (38%)
LRR_8 267..325 CDD:290566 17/59 (29%)
leucine-rich repeat 269..289 CDD:275380 5/21 (24%)
leucine-rich repeat 292..314 CDD:275380 6/21 (29%)
leucine-rich repeat 315..337 CDD:275380 5/20 (25%)
LRR_4 337..375 CDD:289563
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
PIRL4NP_195272.1 LRR 194..>471 CDD:227223 85/232 (37%)
leucine-rich repeat 271..293 CDD:275380 8/21 (38%)
leucine-rich repeat 294..316 CDD:275380 8/21 (38%)
leucine-rich repeat 317..339 CDD:275380 11/21 (52%)
leucine-rich repeat 340..362 CDD:275380 9/21 (43%)
leucine-rich repeat 363..385 CDD:275380 9/21 (43%)
leucine-rich repeat 386..408 CDD:275380 8/21 (38%)
leucine-rich repeat 409..431 CDD:275380 7/21 (33%)
leucine-rich repeat 432..456 CDD:275380 6/23 (26%)
leucine-rich repeat 457..479 CDD:275380 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.