DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and PIRL2

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_189281.2 Gene:PIRL2 / 822257 AraportID:AT3G26500 Length:471 Species:Arabidopsis thaliana


Alignment Length:305 Identity:90/305 - (29%)
Similarity:145/305 - (47%) Gaps:54/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFKGCNRQVEFVDKRHCSLPQVPEEILR-YSR---------------------------TLEELF 43
            |:.|..|..|..|.....|....||:.| ||.                           |:|.:.
plant   102 IYAGVVRLDEVHDSYEKKLKDTEEELSRVYSTEVESMLRSGEEVNEKVLAVLKEAESGGTVERID 166

  Fly    44 LDANHIRDLPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSL 108
            |.:..::.:|:.|:::..|..|.||.|::..:|..|...:.|.|||||.|.:..:||.|..|.:|
plant   167 LSSQELKLIPEAFWKVVGLVYLNLSGNDLTFIPDAISKLKKLEELDVSSNSLESLPDSIGMLLNL 231

  Fly   109 QVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFG-SLTQLESLELRENLLKHLPETIS 172
            ::.:.::|.:..||...:..::|..|..:..:||:||.:.| .|..||.|.::.|.|::.|.:||
plant   232 RILNVNANNLTALPESIAHCRSLVELDASYNNLTSLPTNIGYGLQNLERLSIQLNKLRYFPGSIS 296

  Fly   173 QLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSE--NRLEE 235
            ::..||.||...|||..                       :|..:|.||||..|::|.  |.|..
plant   297 EMYNLKYLDAHMNEIHG-----------------------IPNSIGRLTKLEVLNLSSNFNNLMG 338

  Fly   236 LPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQ 280
            :|:.|:.|.:|.:|||:.|.::|:||...:|.:|..|.||||.|:
plant   339 VPDTITDLTNLRELDLSNNQIQAIPDSFYRLRKLEKLNLDQNPLE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 88/299 (29%)
leucine-rich repeat 18..38 CDD:275380 7/47 (15%)
LRR_8 37..95 CDD:290566 19/84 (23%)
leucine-rich repeat 39..61 CDD:275380 4/21 (19%)
leucine-rich repeat 62..84 CDD:275380 7/21 (33%)
LRR_8 84..138 CDD:290566 17/53 (32%)
leucine-rich repeat 85..107 CDD:275380 11/21 (52%)
leucine-rich repeat 108..130 CDD:275380 4/21 (19%)
LRR_8 129..187 CDD:290566 21/58 (36%)
leucine-rich repeat 131..153 CDD:275380 8/22 (36%)
leucine-rich repeat 154..176 CDD:275380 8/21 (38%)
leucine-rich repeat 177..199 CDD:275380 7/21 (33%)
LRR_8 198..256 CDD:290566 18/59 (31%)
leucine-rich repeat 200..222 CDD:275380 3/21 (14%)
leucine-rich repeat 223..245 CDD:275380 8/23 (35%)
LRR_8 267..325 CDD:290566 7/14 (50%)
leucine-rich repeat 269..289 CDD:275380 7/12 (58%)
leucine-rich repeat 292..314 CDD:275380
leucine-rich repeat 315..337 CDD:275380
LRR_4 337..375 CDD:289563
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
PIRL2NP_189281.2 leucine-rich repeat 162..184 CDD:275380 4/21 (19%)
LRR_RI 169..408 CDD:238064 76/238 (32%)
LRR_8 184..241 CDD:290566 20/56 (36%)
leucine-rich repeat 185..207 CDD:275380 7/21 (33%)
leucine-rich repeat 208..230 CDD:275380 11/21 (52%)
LRR_8 230..288 CDD:290566 16/57 (28%)
leucine-rich repeat 231..253 CDD:275380 4/21 (19%)
leucine-rich repeat 254..277 CDD:275380 8/22 (36%)
leucine-rich repeat 278..300 CDD:275380 8/21 (38%)
leucine-rich repeat 301..323 CDD:275380 10/44 (23%)
LRR_8 322..382 CDD:290566 25/59 (42%)
leucine-rich repeat 324..348 CDD:275380 8/23 (35%)
leucine-rich repeat 349..371 CDD:275380 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.