DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and LRRC8E

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001255213.1 Gene:LRRC8E / 80131 HGNCID:26272 Length:796 Species:Homo sapiens


Alignment Length:395 Identity:110/395 - (27%)
Similarity:178/395 - (45%) Gaps:91/395 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CSLPQVPEEILRYSRTLEELFLDANHIRDL--PKNFFRLHRLRKLGLSDNEIGRLPPDIQNF--E 83
            |.||.:|:.:...|. :|.|.|:|  |.|:  |....:|..|::|.|..:. .|||..:|.|  :
Human   424 CMLPGLPDTVFELSE-VESLRLEA--ICDITFPPGLSQLVHLQELSLLHSP-ARLPFSLQVFLRD 484

  Fly    84 NLVELDVSRNDIPDIP----------------------------DDIKHLQSLQVADFSSNPIPK 120
            :|..:.|...::.::|                            :.::.|:.|:|....|| ..|
Human   485 HLKVMRVKCEELREVPLWVFGLRGLEELHLEGLFPQELARAATLESLRELKQLKVLSLRSN-AGK 548

  Fly   121 LPSGFS----QLKNLT-------VLGLNDM--------------SLTTLPADFGSLTQLESLELR 160
            :|:..:    .|:.|:       ::.||.:              .|..:|....||..|:.|:|:
Human   549 VPASVTDVAGHLQRLSLHNDGARLVALNSLKKLAALRELELVACGLERIPHAVFSLGALQELDLK 613

  Fly   161 ENLLKHLPETIS--QLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKL 223
            :|.|:.:.|.:|  ...||..|.|..|:|..:|.::..|..|.:|:|.:|:|:.||.:|||.:.|
Human   614 DNHLRSIEEILSFQHCRKLVTLRLWHNQIAYVPEHVRKLRSLEQLYLSYNKLETLPSQLGLCSGL 678

  Fly   224 TYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGN 288
            ..||||.|.|..||.|:..|.:|..|.|:.|.|||||                       :.|..
Human   679 RLLDVSHNGLHSLPPEVGLLQNLQHLALSYNALEALP-----------------------EELFF 720

  Fly   289 CENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANL---GVLSLRDNKLKK 350
            |..::.|:|.:|.||:|...:|.:..|:.|.:..|.||.||.|:|.|..|   |:| :.|...:.
Human   721 CRKLRTLLLGDNQLSQLSPHVGALRALSRLELKGNRLEALPEELGNCGGLKKAGLL-VEDTLYQG 784

  Fly   351 LPPEL 355
            ||.|:
Human   785 LPAEV 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 84/318 (26%)
leucine-rich repeat 18..38 CDD:275380 5/14 (36%)
LRR_8 37..95 CDD:290566 18/61 (30%)
leucine-rich repeat 39..61 CDD:275380 8/23 (35%)
leucine-rich repeat 62..84 CDD:275380 8/23 (35%)
LRR_8 84..138 CDD:290566 13/92 (14%)
leucine-rich repeat 85..107 CDD:275380 4/49 (8%)
leucine-rich repeat 108..130 CDD:275380 7/25 (28%)
LRR_8 129..187 CDD:290566 19/80 (24%)
leucine-rich repeat 131..153 CDD:275380 7/42 (17%)
leucine-rich repeat 154..176 CDD:275380 7/23 (30%)
leucine-rich repeat 177..199 CDD:275380 7/21 (33%)
LRR_8 198..256 CDD:290566 25/57 (44%)
leucine-rich repeat 200..222 CDD:275380 10/21 (48%)
leucine-rich repeat 223..245 CDD:275380 11/21 (52%)
LRR_8 267..325 CDD:290566 12/57 (21%)
leucine-rich repeat 269..289 CDD:275380 1/19 (5%)
leucine-rich repeat 292..314 CDD:275380 7/21 (33%)
leucine-rich repeat 315..337 CDD:275380 10/21 (48%)
LRR_4 337..375 CDD:289563 7/22 (32%)
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
LRRC8ENP_001255213.1 Pannexin_like 1..331 CDD:289311
leucine-rich repeat 486..508 CDD:275380 3/21 (14%)
LRR 1 508..529 0/20 (0%)
leucine-rich repeat 509..527 CDD:275380 0/17 (0%)
LRR_RI 520..760 CDD:238064 74/263 (28%)
LRR 2 536..557 6/21 (29%)
leucine-rich repeat 537..559 CDD:275380 6/22 (27%)
LRR 3 559..579 4/19 (21%)
leucine-rich repeat 560..583 CDD:275380 4/22 (18%)
LRR 4 583..604 2/20 (10%)
LRR_8 584..642 CDD:290566 16/57 (28%)
leucine-rich repeat 584..606 CDD:275380 4/21 (19%)
LRR 5 606..627 7/20 (35%)
leucine-rich repeat 607..631 CDD:275380 7/23 (30%)
LRR_8 630..688 CDD:290566 24/57 (42%)
LRR 6 631..652 7/20 (35%)
leucine-rich repeat 632..654 CDD:275380 7/21 (33%)
LRR 7 654..675 9/20 (45%)
leucine-rich repeat 655..677 CDD:275380 10/21 (48%)
LRR_8 676..734 CDD:290566 25/80 (31%)
LRR 8 677..698 10/20 (50%)
leucine-rich repeat 678..700 CDD:275380 11/21 (52%)
LRR 9 700..721 10/43 (23%)
leucine-rich repeat 701..723 CDD:275380 11/44 (25%)
LRR 10 723..744 7/20 (35%)
leucine-rich repeat 724..746 CDD:275380 7/21 (33%)
LRR 11 746..767 9/20 (45%)
leucine-rich repeat 747..767 CDD:275380 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.