| Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001255213.1 | Gene: | LRRC8E / 80131 | HGNCID: | 26272 | Length: | 796 | Species: | Homo sapiens |
| Alignment Length: | 395 | Identity: | 110/395 - (27%) |
|---|---|---|---|
| Similarity: | 178/395 - (45%) | Gaps: | 91/395 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 23 CSLPQVPEEILRYSRTLEELFLDANHIRDL--PKNFFRLHRLRKLGLSDNEIGRLPPDIQNF--E 83
Fly 84 NLVELDVSRNDIPDIP----------------------------DDIKHLQSLQVADFSSNPIPK 120
Fly 121 LPSGFS----QLKNLT-------VLGLNDM--------------SLTTLPADFGSLTQLESLELR 160
Fly 161 ENLLKHLPETIS--QLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKL 223
Fly 224 TYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGN 288
Fly 289 CENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANL---GVLSLRDNKLKK 350
Fly 351 LPPEL 355 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| scrib | NP_001163746.1 | LRR_RI | 13..283 | CDD:238064 | 84/318 (26%) |
| leucine-rich repeat | 18..38 | CDD:275380 | 5/14 (36%) | ||
| LRR_8 | 37..95 | CDD:290566 | 18/61 (30%) | ||
| leucine-rich repeat | 39..61 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 62..84 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 84..138 | CDD:290566 | 13/92 (14%) | ||
| leucine-rich repeat | 85..107 | CDD:275380 | 4/49 (8%) | ||
| leucine-rich repeat | 108..130 | CDD:275380 | 7/25 (28%) | ||
| LRR_8 | 129..187 | CDD:290566 | 19/80 (24%) | ||
| leucine-rich repeat | 131..153 | CDD:275380 | 7/42 (17%) | ||
| leucine-rich repeat | 154..176 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 177..199 | CDD:275380 | 7/21 (33%) | ||
| LRR_8 | 198..256 | CDD:290566 | 25/57 (44%) | ||
| leucine-rich repeat | 200..222 | CDD:275380 | 10/21 (48%) | ||
| leucine-rich repeat | 223..245 | CDD:275380 | 11/21 (52%) | ||
| LRR_8 | 267..325 | CDD:290566 | 12/57 (21%) | ||
| leucine-rich repeat | 269..289 | CDD:275380 | 1/19 (5%) | ||
| leucine-rich repeat | 292..314 | CDD:275380 | 7/21 (33%) | ||
| leucine-rich repeat | 315..337 | CDD:275380 | 10/21 (48%) | ||
| LRR_4 | 337..375 | CDD:289563 | 7/22 (32%) | ||
| leucine-rich repeat | 361..382 | CDD:275380 | |||
| PDZ | 728..816 | CDD:214570 | |||
| PDZ_signaling | 931..1016 | CDD:238492 | |||
| PDZ | 1239..1329 | CDD:214570 | |||
| PDZ_signaling | 1336..1425 | CDD:238492 | |||
| LRRC8E | NP_001255213.1 | Pannexin_like | 1..331 | CDD:289311 | |
| leucine-rich repeat | 486..508 | CDD:275380 | 3/21 (14%) | ||
| LRR 1 | 508..529 | 0/20 (0%) | |||
| leucine-rich repeat | 509..527 | CDD:275380 | 0/17 (0%) | ||
| LRR_RI | 520..760 | CDD:238064 | 74/263 (28%) | ||
| LRR 2 | 536..557 | 6/21 (29%) | |||
| leucine-rich repeat | 537..559 | CDD:275380 | 6/22 (27%) | ||
| LRR 3 | 559..579 | 4/19 (21%) | |||
| leucine-rich repeat | 560..583 | CDD:275380 | 4/22 (18%) | ||
| LRR 4 | 583..604 | 2/20 (10%) | |||
| LRR_8 | 584..642 | CDD:290566 | 16/57 (28%) | ||
| leucine-rich repeat | 584..606 | CDD:275380 | 4/21 (19%) | ||
| LRR 5 | 606..627 | 7/20 (35%) | |||
| leucine-rich repeat | 607..631 | CDD:275380 | 7/23 (30%) | ||
| LRR_8 | 630..688 | CDD:290566 | 24/57 (42%) | ||
| LRR 6 | 631..652 | 7/20 (35%) | |||
| leucine-rich repeat | 632..654 | CDD:275380 | 7/21 (33%) | ||
| LRR 7 | 654..675 | 9/20 (45%) | |||
| leucine-rich repeat | 655..677 | CDD:275380 | 10/21 (48%) | ||
| LRR_8 | 676..734 | CDD:290566 | 25/80 (31%) | ||
| LRR 8 | 677..698 | 10/20 (50%) | |||
| leucine-rich repeat | 678..700 | CDD:275380 | 11/21 (52%) | ||
| LRR 9 | 700..721 | 10/43 (23%) | |||
| leucine-rich repeat | 701..723 | CDD:275380 | 11/44 (25%) | ||
| LRR 10 | 723..744 | 7/20 (35%) | |||
| leucine-rich repeat | 724..746 | CDD:275380 | 7/21 (33%) | ||
| LRR 11 | 746..767 | 9/20 (45%) | |||
| leucine-rich repeat | 747..767 | CDD:275380 | 9/19 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||