DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and Lrrc15

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_083249.1 Gene:Lrrc15 / 74488 MGIID:1921738 Length:579 Species:Mus musculus


Alignment Length:536 Identity:145/536 - (27%)
Similarity:223/536 - (41%) Gaps:97/536 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CNR--QVEFVDKRHCSLP------------------QVPEEILRYSRTLEELFLDANHIRD-LPK 54
            |:|  |||....:..::|                  ::||:.......|..|.::.|.:.: :|.
Mouse    31 CSRASQVECTGAQIVAMPSPLPWNAMSLQILNTHITELPEDKFLNISALIALKMEKNELANIMPG 95

  Fly    55 NFFRLHRLRKLGLSDNEIGRLP----PDIQNFENLVELDVSRNDIPDI-PDDIKHLQSLQVADFS 114
            .|..|..||.|.|::|::..||    .|:.|.|.|:   :|.|.:..| |.......:|:.....
Mouse    96 AFRNLGSLRHLSLANNKLKNLPVRLFQDVNNLETLL---LSNNQLVQIQPAQFSQFSNLKELQLY 157

  Fly   115 SNPIPKLPSG-FSQLKNLTVLGLNDMSLTTL-PADFGSLTQLESLELRENLLKHLP-ETISQLTK 176
            .|.:..:|.| |..|..||.|.|.:...|.| |..|..|..|:.|.|.||.|..:| .|...|..
Mouse   158 GNNLEYIPEGVFDHLVGLTKLNLGNNGFTHLSPRVFQHLGNLQVLRLYENRLSDIPMGTFDALGN 222

  Fly   177 LKRLDLGDNEIEDLPPYLGY-LPGLHELWLDHNQLQRLPP----ELGLLTKLTYLDVSENRLEEL 236
            |:.|.|.:|:|..|.|.|.: ...|..|:|.:|.:..|||    :|..|.|||...   |.|:||
Mouse   223 LQELALQENQIGTLSPGLFHNNRNLQRLYLSNNHISHLPPGIFMQLPHLNKLTLFG---NSLKEL 284

  Fly   237 -PNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN 300
             |.....:.:|.:|.|..|.:.:|||               |....||       .:|.|||:.|
Mouse   285 SPGVFGPMPNLRELWLYNNHITSLPD---------------NAFSHLN-------QLQVLILSHN 327

  Fly   301 FLSEL-PASIGQMTKLNNLNVDRNALEYLPLEI-GQCANLGVLSLRDNKLKKLPPEL-GNCTVLH 362
            .||.: |.:...:|.|..|::..|||:.|...: ...|||..:||::|:|::||..: .|...|.
Mouse   328 QLSYISPGAFNGLTNLRELSLHTNALQDLDGNVFRSLANLRNVSLQNNRLRQLPGSIFANVNGLM 392

  Fly   363 VLDVSGNQLLYLPY-------SLVNLQL-KAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQ 419
            .:.:..|.|..||.       :|..|:| ...|..::...||..:.....|..|...|       
Mouse   393 TIQLQNNNLENLPLGIFDHLGNLCELRLYDNPWRCDSNILPLHDWLILNRARLGTDTL------- 450

  Fly   420 QEYQPITPARDLESDSEPFEEREPSRTV--VKFSEEATQEKETPFVRQ--NTPHPKDLKAKAQKL 480
                |:.        |.|...|..|..:  |.|...:.|..|||.|..  :|....|..:.:...
Mouse   451 ----PVC--------SSPASVRGQSLVIINVNFPGPSVQGPETPEVSSYPDTSSYPDSTSISSTT 503

  Fly   481 KVERSRNEEHANLVTL 496
            ::.||.::::.:|.|:
Mouse   504 EITRSTDDDYTDLNTI 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 85/304 (28%)
leucine-rich repeat 18..38 CDD:275380 3/37 (8%)
LRR_8 37..95 CDD:290566 19/62 (31%)
leucine-rich repeat 39..61 CDD:275380 6/22 (27%)
leucine-rich repeat 62..84 CDD:275380 9/25 (36%)
LRR_8 84..138 CDD:290566 15/55 (27%)
leucine-rich repeat 85..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..130 CDD:275380 6/22 (27%)
LRR_8 129..187 CDD:290566 22/59 (37%)
leucine-rich repeat 131..153 CDD:275380 9/22 (41%)
leucine-rich repeat 154..176 CDD:275380 9/22 (41%)
leucine-rich repeat 177..199 CDD:275380 8/22 (36%)
LRR_8 198..256 CDD:290566 21/62 (34%)
leucine-rich repeat 200..222 CDD:275380 9/25 (36%)
leucine-rich repeat 223..245 CDD:275380 7/22 (32%)
LRR_8 267..325 CDD:290566 15/58 (26%)
leucine-rich repeat 269..289 CDD:275380 3/19 (16%)
leucine-rich repeat 292..314 CDD:275380 8/22 (36%)
leucine-rich repeat 315..337 CDD:275380 6/22 (27%)
LRR_4 337..375 CDD:289563 12/38 (32%)
leucine-rich repeat 361..382 CDD:275380 6/27 (22%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
Lrrc15NP_083249.1 LRR 1 54..75 2/20 (10%)
leucine-rich repeat 58..78 CDD:275380 2/19 (11%)
LRR 2 78..99 5/20 (25%)
PLN00113 82..>401 CDD:215061 106/346 (31%)
LRR 3 102..123 7/20 (35%)
leucine-rich repeat 103..126 CDD:275380 8/22 (36%)
LRR 4 126..147 7/23 (30%)
leucine-rich repeat 127..150 CDD:275380 6/25 (24%)
LRR 5 150..171 5/20 (25%)
leucine-rich repeat 151..174 CDD:275380 6/22 (27%)
LRR 6 174..195 8/20 (40%)
leucine-rich repeat 175..198 CDD:275380 9/22 (41%)
LRR 7 198..219 8/20 (40%)
leucine-rich repeat 199..222 CDD:275380 9/22 (41%)
LRR 8 222..243 8/20 (40%)
leucine-rich repeat 223..246 CDD:275380 8/22 (36%)
LRR 9 246..267 7/20 (35%)
leucine-rich repeat 247..270 CDD:275380 8/22 (36%)
LRR 10 270..291 9/23 (39%)
leucine-rich repeat 271..294 CDD:275380 9/25 (36%)
LRR 11 294..315 8/35 (23%)
leucine-rich repeat 295..318 CDD:275380 10/44 (23%)
LRR 12 318..339 8/20 (40%)
leucine-rich repeat 319..342 CDD:275380 8/22 (36%)
LRR 13 342..363 6/20 (30%)
leucine-rich repeat 343..364 CDD:275380 6/20 (30%)
LRR 14 366..387 8/20 (40%)
leucine-rich repeat 367..387 CDD:275380 7/19 (37%)
LRR 15 390..411 5/20 (25%)
leucine-rich repeat 391..412 CDD:275380 5/20 (25%)
LRRCT 423..>462 CDD:214507 10/57 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..509 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.