DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and Lrrc57

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001153082.1 Gene:Lrrc57 / 66606 MGIID:1913856 Length:281 Species:Mus musculus


Alignment Length:285 Identity:78/285 - (27%)
Similarity:124/285 - (43%) Gaps:60/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RLHRLRKLGL-------SDNEIGR--------LPPDIQNFENLVELDVSRNDIPDIPDDIKHLQS 107
            ||.|.|..|:       ::.|:.|        |...::..:......:....:.:.|.:::.|.|
Mouse    16 RLRRARVPGVPWRSLLCTERELSRGARMGNSALRAHVETAQKTGVFQLKDRGLTEFPSELQKLTS 80

  Fly   108 -LQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETI 171
             |:..|.|:|.|..||                      |...|..|.|:||.|..|.|..||:.:
Mouse    81 NLRTIDLSNNKIDSLP----------------------PLIIGKFTLLKSLSLNNNKLTVLPDEL 123

  Fly   172 SQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEEL 236
            ..|.||:.|.|.:|.:.:||...|.|..|..|.|..|||..|||:|..|..|..:|:|:|::..:
Mouse   124 CNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKNQIRSI 188

  Fly   237 PNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENF 301
            |:.:..|.:: :|:|.||.:..|...|:...||.:|:|::|.|:                     
Mouse   189 PDTVGELQAI-ELNLNQNQISQLSVKISCCPRLKVLRLEENCLE--------------------- 231

  Fly   302 LSELPASIGQMTKLNNLNVDRNALE 326
            ||.||.||...:::..|.|:.|..|
Mouse   232 LSMLPQSILSDSQICLLAVEGNLFE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 68/240 (28%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566 8/51 (16%)
leucine-rich repeat 39..61 CDD:275380 2/2 (100%)
leucine-rich repeat 62..84 CDD:275380 5/36 (14%)
LRR_8 84..138 CDD:290566 10/54 (19%)
leucine-rich repeat 85..107 CDD:275380 2/21 (10%)
leucine-rich repeat 108..130 CDD:275380 7/21 (33%)
LRR_8 129..187 CDD:290566 17/57 (30%)
leucine-rich repeat 131..153 CDD:275380 2/21 (10%)
leucine-rich repeat 154..176 CDD:275380 9/21 (43%)
leucine-rich repeat 177..199 CDD:275380 8/21 (38%)
LRR_8 198..256 CDD:290566 21/57 (37%)
leucine-rich repeat 200..222 CDD:275380 11/21 (52%)
leucine-rich repeat 223..245 CDD:275380 6/21 (29%)
LRR_8 267..325 CDD:290566 15/57 (26%)
leucine-rich repeat 269..289 CDD:275380 5/19 (26%)
leucine-rich repeat 292..314 CDD:275380 6/21 (29%)
leucine-rich repeat 315..337 CDD:275380 4/12 (33%)
LRR_4 337..375 CDD:289563
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
Lrrc57NP_001153082.1 LRR <62..>211 CDD:227223 52/171 (30%)
leucine-rich repeat 82..105 CDD:275380 9/44 (20%)
leucine-rich repeat 106..128 CDD:275380 9/21 (43%)
leucine-rich repeat 129..151 CDD:275380 8/21 (38%)
leucine-rich repeat 152..174 CDD:275380 11/21 (52%)
leucine-rich repeat 175..197 CDD:275380 6/21 (29%)
leucine-rich repeat 198..219 CDD:275380 6/21 (29%)
leucine-rich repeat 220..241 CDD:275380 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.