Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001153082.1 | Gene: | Lrrc57 / 66606 | MGIID: | 1913856 | Length: | 281 | Species: | Mus musculus |
Alignment Length: | 285 | Identity: | 78/285 - (27%) |
---|---|---|---|
Similarity: | 124/285 - (43%) | Gaps: | 60/285 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 RLHRLRKLGL-------SDNEIGR--------LPPDIQNFENLVELDVSRNDIPDIPDDIKHLQS 107
Fly 108 -LQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETI 171
Fly 172 SQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEEL 236
Fly 237 PNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENF 301
Fly 302 LSELPASIGQMTKLNNLNVDRNALE 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scrib | NP_001163746.1 | LRR_RI | 13..283 | CDD:238064 | 68/240 (28%) |
leucine-rich repeat | 18..38 | CDD:275380 | |||
LRR_8 | 37..95 | CDD:290566 | 8/51 (16%) | ||
leucine-rich repeat | 39..61 | CDD:275380 | 2/2 (100%) | ||
leucine-rich repeat | 62..84 | CDD:275380 | 5/36 (14%) | ||
LRR_8 | 84..138 | CDD:290566 | 10/54 (19%) | ||
leucine-rich repeat | 85..107 | CDD:275380 | 2/21 (10%) | ||
leucine-rich repeat | 108..130 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 129..187 | CDD:290566 | 17/57 (30%) | ||
leucine-rich repeat | 131..153 | CDD:275380 | 2/21 (10%) | ||
leucine-rich repeat | 154..176 | CDD:275380 | 9/21 (43%) | ||
leucine-rich repeat | 177..199 | CDD:275380 | 8/21 (38%) | ||
LRR_8 | 198..256 | CDD:290566 | 21/57 (37%) | ||
leucine-rich repeat | 200..222 | CDD:275380 | 11/21 (52%) | ||
leucine-rich repeat | 223..245 | CDD:275380 | 6/21 (29%) | ||
LRR_8 | 267..325 | CDD:290566 | 15/57 (26%) | ||
leucine-rich repeat | 269..289 | CDD:275380 | 5/19 (26%) | ||
leucine-rich repeat | 292..314 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 315..337 | CDD:275380 | 4/12 (33%) | ||
LRR_4 | 337..375 | CDD:289563 | |||
leucine-rich repeat | 361..382 | CDD:275380 | |||
PDZ | 728..816 | CDD:214570 | |||
PDZ_signaling | 931..1016 | CDD:238492 | |||
PDZ | 1239..1329 | CDD:214570 | |||
PDZ_signaling | 1336..1425 | CDD:238492 | |||
Lrrc57 | NP_001153082.1 | LRR | <62..>211 | CDD:227223 | 52/171 (30%) |
leucine-rich repeat | 82..105 | CDD:275380 | 9/44 (20%) | ||
leucine-rich repeat | 106..128 | CDD:275380 | 9/21 (43%) | ||
leucine-rich repeat | 129..151 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 152..174 | CDD:275380 | 11/21 (52%) | ||
leucine-rich repeat | 175..197 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 198..219 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 220..241 | CDD:275380 | 11/41 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |