DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and si:dkey-1h4.4

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:XP_021333533.1 Gene:si:dkey-1h4.4 / 566734 ZFINID:ZDB-GENE-160728-41 Length:251 Species:Danio rerio


Alignment Length:224 Identity:80/224 - (35%)
Similarity:115/224 - (51%) Gaps:1/224 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 QLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPEL 217
            |.|||.:....|..||..:|:|..||:|.|.:|::...|..:.:|..|.||.||.|||..||..:
Zfish    14 QQESLNMSHRGLVVLPPGVSRLVTLKKLFLNNNQLILPPDEILHLEKLEELILDRNQLTMLPSNI 78

  Fly   218 GLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRL 282
            |.|..||||.::.|.|..||..:..|..|.:|......|.:||..|.|||:|..|.:..|.:..|
Zfish    79 GSLKHLTYLGINHNPLSVLPEALGDLTELRELWAVGCGLISLPSSIGKLSKLQKLGVHNNIITNL 143

  Fly   283 NDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNK 347
            ....|:..|:|.|.|.:|.|.:||..|..:..|..:|:|:|....:|..:...|||.:|||:.|.
Zfish   144 PSQFGSLSNLQWLNLADNKLQDLPEDINHLPSLVFINLDKNCFTDIPTVLTDMANLQILSLKFNS 208

  Fly   348 LKKLPPEL-GNCTVLHVLDVSGNQLLYLP 375
            ::.|...| ...:.|..||:..|.|:..|
Zfish   209 IRTLEDYLIPGFSRLTKLDIRENPLMDRP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 49/129 (38%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380
LRR_8 84..138 CDD:290566
leucine-rich repeat 85..107 CDD:275380
leucine-rich repeat 108..130 CDD:275380
LRR_8 129..187 CDD:290566 14/33 (42%)
leucine-rich repeat 131..153 CDD:275380 80/224 (36%)
leucine-rich repeat 154..176 CDD:275380 8/21 (38%)
leucine-rich repeat 177..199 CDD:275380 7/21 (33%)
LRR_8 198..256 CDD:290566 23/57 (40%)
leucine-rich repeat 200..222 CDD:275380 12/21 (57%)
leucine-rich repeat 223..245 CDD:275380 9/21 (43%)
LRR_8 267..325 CDD:290566 19/57 (33%)
leucine-rich repeat 269..289 CDD:275380 5/19 (26%)
leucine-rich repeat 292..314 CDD:275380 8/21 (38%)
leucine-rich repeat 315..337 CDD:275380 5/21 (24%)
LRR_4 337..375 CDD:289563 13/38 (34%)
leucine-rich repeat 361..382 CDD:275380 6/15 (40%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
si:dkey-1h4.4XP_021333533.1 leucine-rich repeat 16..34 CDD:275380 6/17 (35%)
LRR <32..>238 CDD:227223 73/206 (35%)
leucine-rich repeat 38..60 CDD:275380 7/21 (33%)
leucine-rich repeat 61..83 CDD:275380 12/21 (57%)
leucine-rich repeat 84..106 CDD:275380 9/21 (43%)
leucine-rich repeat 107..129 CDD:275380 8/21 (38%)
leucine-rich repeat 130..152 CDD:275380 5/21 (24%)
leucine-rich repeat 153..175 CDD:275380 8/21 (38%)
leucine-rich repeat 176..198 CDD:275380 5/21 (24%)
leucine-rich repeat 199..222 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.