DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and AgaP_AGAP007468

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:XP_001687916.1 Gene:AgaP_AGAP007468 / 5666871 VectorBaseID:AGAP007468 Length:406 Species:Anopheles gambiae


Alignment Length:348 Identity:85/348 - (24%)
Similarity:146/348 - (41%) Gaps:57/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QVPEEILRYSRTLEEL-FLDANHIRDLPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVE--- 87
            |:|.:     .||.|: .::...:|.|.....|  .|.:|.:.:..:.|:||.:.|...|.|   
Mosquito    61 QLPAD-----NTLTEIEIVNGVMLRSLVAGTNR--HLTRLYVENCLLDRIPPTLSNMIELEELLI 118

  Fly    88 ---------LDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGF-----SQLKNLTVLGLND 138
                     |||..|:......|:...:..|:...::.|..||...|     :||:.|      |
Mosquito   119 MQCALTALRLDVLVNNPKLTTIDLTRNRIRQLFPITTPPKTKLAVTFLGLAANQLERL------D 177

  Fly   139 MSLTTLPADFGSLTQLESLELRENLLKHL----PETISQLTKLKRLDLGDNEIEDLPPYLGYLPG 199
            ||:      |..:.:||..::|.|.:...    |.|...||   ||.:..|.|.........|..
Mosquito   178 MSM------FAFMPELEQFDVRGNRIVRFEATAPVTYGSLT---RLLVSSNNITQFDTRNLTLSE 233

  Fly   200 LHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISG-LVSLTDLDLAQNLLEALPDGI 263
            |..|:||.|.|..||...|.|.||.||....|.|:.:.....| ..:||.:.:::|::|.:....
Mosquito   234 LRSLYLDDNALTELPTHWGKLPKLIYLGFDRNYLKRVDMSFFGKFPTLTAIFISENIVETIRTST 298

  Fly   264 -AKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEY 327
             ..:..|.|:..:.|::..:|.|..|...|..:.||.|.|:.:|..:.:.:: :.|.::.|.:  
Mosquito   299 PITMPELDIILFESNQIVSVNFTGCNFPKMNLVSLTNNRLTTIPPLLQRFSE-SRLTMEGNPI-- 360

  Fly   328 LPLEIGQCANLGVL--SLRDNKL 348
                  :|:::..|  .:.|.:|
Mosquito   361 ------KCSSMTALKSKITDYRL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 70/279 (25%)
leucine-rich repeat 18..38 CDD:275380 2/10 (20%)
LRR_8 37..95 CDD:290566 18/70 (26%)
leucine-rich repeat 39..61 CDD:275380 5/22 (23%)
leucine-rich repeat 62..84 CDD:275380 6/21 (29%)
LRR_8 84..138 CDD:290566 15/70 (21%)
leucine-rich repeat 85..107 CDD:275380 7/33 (21%)
leucine-rich repeat 108..130 CDD:275380 7/26 (27%)
LRR_8 129..187 CDD:290566 16/61 (26%)
leucine-rich repeat 131..153 CDD:275380 5/21 (24%)
leucine-rich repeat 154..176 CDD:275380 7/25 (28%)
leucine-rich repeat 177..199 CDD:275380 5/21 (24%)
LRR_8 198..256 CDD:290566 20/58 (34%)
leucine-rich repeat 200..222 CDD:275380 10/21 (48%)
leucine-rich repeat 223..245 CDD:275380 6/22 (27%)
LRR_8 267..325 CDD:290566 14/57 (25%)
leucine-rich repeat 269..289 CDD:275380 5/19 (26%)
leucine-rich repeat 292..314 CDD:275380 6/21 (29%)
leucine-rich repeat 315..337 CDD:275380 3/21 (14%)
LRR_4 337..375 CDD:289563 3/14 (21%)
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
AgaP_AGAP007468XP_001687916.1 LRR_8 88..147 CDD:290566 14/60 (23%)
leucine-rich repeat 90..112 CDD:275380 6/21 (29%)
leucine-rich repeat 113..136 CDD:275380 6/22 (27%)
LRR_8 135..197 CDD:290566 17/73 (23%)
leucine-rich repeat 137..160 CDD:275380 3/22 (14%)
leucine-rich repeat 161..186 CDD:275380 9/36 (25%)
LRR_8 185..244 CDD:290566 18/61 (30%)
leucine-rich repeat 187..210 CDD:275380 6/22 (27%)
leucine-rich repeat 211..233 CDD:275380 7/24 (29%)
LRR_8 232..289 CDD:290566 19/56 (34%)
leucine-rich repeat 234..256 CDD:275380 10/21 (48%)
leucine-rich repeat 257..280 CDD:275380 6/22 (27%)
leucine-rich repeat 281..304 CDD:275380 4/22 (18%)
leucine-rich repeat 305..327 CDD:275380 6/21 (29%)
leucine-rich repeat 328..351 CDD:275380 6/23 (26%)
leucine-rich repeat 352..370 CDD:275380 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.