DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and Pard6a

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_062669.2 Gene:Pard6a / 56513 MGIID:1927223 Length:346 Species:Mus musculus


Alignment Length:355 Identity:76/355 - (21%)
Similarity:118/355 - (33%) Gaps:117/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1048 PANFSRSVVEVEQPY--KYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFA--TAAAATIDSS 1108
            ||....|:|||:..:  ::...|                    ||.:...||.  :.....:...
Mouse     8 PARSPDSIVEVKSKFDAEFRRFA--------------------LPRTSVRGFQEFSRLLCVVHQI 52

  Fly  1109 TGQPVPAPRRTNSVPMGDGDIGAGSTTS-GDSGEAQPSSLRPLTSDDFQAMIPAHFLSGGSQHQV 1172
            .|.                |:..|.|.: ||        |.|||:||             |.|:.
Mouse    53 PGL----------------DVLLGYTDAHGD--------LLPLTNDD-------------SLHRA 80

  Fly  1173 HVARP-------------NEVGVSAVTVNVNKPQPDLPMFPAA------------PTELGRVTET 1212
            ..:.|             :..|::..:.::.:.:..|.:.|.|            |.:..:|:..
Mouse    81 LASGPPPLRLLVQKRAEGDSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSV 145

  Fly  1213 ITKSTFTETVMTRITDNQLAEPLISEEVVLPKNQGS---LGFSIIGGTDHSCVPFG-TREPGIFI 1273
            |......||               ...|.|.|: ||   |||.|..|......|.| .|.|||||
Mouse   146 IDVDLLPET---------------HRRVRLHKH-GSDRPLGFYIRDGMSVRVAPQGLERVPGIFI 194

  Fly  1274 SHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVL 1338
            |.:|.||:|...|.|.:.|.||:||..:|:..|.......::.....:.:|::    |...:..:
Mouse   195 SRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVK----PANQRNNV 255

  Fly  1339 LSKAEGERLGMHIKGGLNGQRGNPADPSDE 1368
            :..|.|...|....|      ..|.||..:
Mouse   256 VRGASGRLTGPSSVG------PGPTDPDSD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380
LRR_8 84..138 CDD:290566
leucine-rich repeat 85..107 CDD:275380
leucine-rich repeat 108..130 CDD:275380
LRR_8 129..187 CDD:290566
leucine-rich repeat 131..153 CDD:275380
leucine-rich repeat 154..176 CDD:275380
leucine-rich repeat 177..199 CDD:275380
LRR_8 198..256 CDD:290566
leucine-rich repeat 200..222 CDD:275380
leucine-rich repeat 223..245 CDD:275380
LRR_8 267..325 CDD:290566
leucine-rich repeat 269..289 CDD:275380
leucine-rich repeat 292..314 CDD:275380
leucine-rich repeat 315..337 CDD:275380
LRR_4 337..375 CDD:289563
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570 33/93 (35%)
PDZ_signaling 1336..1425 CDD:238492 7/33 (21%)
Pard6aNP_062669.2 Interaction with PRKCI and PRKCZ. /evidence=ECO:0000250 1..116 27/164 (16%)
PB1_Par6 16..95 CDD:99724 23/135 (17%)
Interaction with PARD3 and CDC42. /evidence=ECO:0000250 126..253 39/146 (27%)
PDZ_signaling 156..247 CDD:238492 33/91 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..292 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.