DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment scrib and Htra1

DIOPT Version :9

Sequence 1:	NP_001163746.1	Gene:	scrib / 44448	FlyBaseID:	FBgn0263289	Length:	2585	Species:	Drosophila melanogaster
Sequence 2:	NP_062510.2	Gene:	Htra1 / 56213	MGIID:	1929076	Length:	480	Species:	Mus musculus

Alignment Length:	166	Identity:	40/166 - (24%)
Similarity:	55/166 - (33%)	Gaps:	60/166 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   718 NLDGVTELRLEQYEIHIERTAAGLGLSI----------------AGGKGST-------------- 752
            ||||      |...|:..:..||:..:|                |.||..|
Mouse   334 NLDG------EVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAVTKKKYIGIRMMSLTS 392

  Fly   753 -----------PFKGDDDGIFISRVTEAGPADLAGLKVGDKVIKVNGIVVVDADHYQAVQVLKAC 806
                       .|.....|.:|..|....||:..|||..|.:|.:||..||.|:  ....|:|.
Mouse   393 SKAKELKDRHRDFPDVLSGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVTAN--DVSDVIKK- 454

  Fly   807 GAVLVLVVQREVTRLIGHPVFSEDGSVSQISVETRP 842
            ...|.:||:|.          :||..::.|..|..|
Mouse   455 ENTLNMVVRRG----------NEDIVITVIPEEIDP 480

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
scrib	NP_001163746.1	LRR_RI	13..283	CDD:238064
		leucine-rich repeat	18..38	CDD:275380
		LRR_8	37..95	CDD:290566
		leucine-rich repeat	39..61	CDD:275380
		leucine-rich repeat	62..84	CDD:275380
		LRR_8	84..138	CDD:290566
		leucine-rich repeat	85..107	CDD:275380
		leucine-rich repeat	108..130	CDD:275380
		LRR_8	129..187	CDD:290566
		leucine-rich repeat	131..153	CDD:275380
		leucine-rich repeat	154..176	CDD:275380
		leucine-rich repeat	177..199	CDD:275380
		LRR_8	198..256	CDD:290566
		leucine-rich repeat	200..222	CDD:275380
		leucine-rich repeat	223..245	CDD:275380
		LRR_8	267..325	CDD:290566
		leucine-rich repeat	269..289	CDD:275380
		leucine-rich repeat	292..314	CDD:275380
		leucine-rich repeat	315..337	CDD:275380
		LRR_4	337..375	CDD:289563
		leucine-rich repeat	361..382	CDD:275380
		PDZ	728..816	CDD:214570	30/128 (23%)
		PDZ_signaling	931..1016	CDD:238492
		PDZ	1239..1329	CDD:214570
		PDZ_signaling	1336..1425	CDD:238492
Htra1	NP_062510.2	IB	37..111	CDD:197525
		KAZAL	115..155	CDD:197624
		DegQ	154..480	CDD:223343	39/164 (24%)
		Serine protease	204..364		9/35 (26%)
		Trypsin_2	204..342	CDD:290102	5/13 (38%)
		PDZ_serine_protease	382..473	CDD:238487	24/103 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910