| Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001032463.1 | Gene: | ppp1r7 / 560323 | ZFINID: | ZDB-GENE-051113-288 | Length: | 345 | Species: | Danio rerio |
| Alignment Length: | 321 | Identity: | 86/321 - (26%) |
|---|---|---|---|
| Similarity: | 149/321 - (46%) | Gaps: | 69/321 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 EFVDKRHCSLPQVPE-EILRYSRTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDNEIGRLPPDI 79
Fly 80 QNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTL 144
Fly 145 PADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQ 209
Fly 210 LQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKL 274
Fly 275 DQNRLQRLNDTLGNCENMQELILTEN------FLSELPASIGQMTKLNNLNVDRNALEYLP 329 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| scrib | NP_001163746.1 | LRR_RI | 13..283 | CDD:238064 | 75/267 (28%) |
| leucine-rich repeat | 18..38 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 37..95 | CDD:290566 | 21/57 (37%) | ||
| leucine-rich repeat | 39..61 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 62..84 | CDD:275380 | 9/21 (43%) | ||
| LRR_8 | 84..138 | CDD:290566 | 13/53 (25%) | ||
| leucine-rich repeat | 85..107 | CDD:275380 | 8/21 (38%) | ||
| leucine-rich repeat | 108..130 | CDD:275380 | 1/21 (5%) | ||
| LRR_8 | 129..187 | CDD:290566 | 19/57 (33%) | ||
| leucine-rich repeat | 131..153 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 154..176 | CDD:275380 | 7/21 (33%) | ||
| leucine-rich repeat | 177..199 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 198..256 | CDD:290566 | 15/57 (26%) | ||
| leucine-rich repeat | 200..222 | CDD:275380 | 2/21 (10%) | ||
| leucine-rich repeat | 223..245 | CDD:275380 | 7/21 (33%) | ||
| LRR_8 | 267..325 | CDD:290566 | 13/63 (21%) | ||
| leucine-rich repeat | 269..289 | CDD:275380 | 4/19 (21%) | ||
| leucine-rich repeat | 292..314 | CDD:275380 | 6/27 (22%) | ||
| leucine-rich repeat | 315..337 | CDD:275380 | 5/15 (33%) | ||
| LRR_4 | 337..375 | CDD:289563 | |||
| leucine-rich repeat | 361..382 | CDD:275380 | |||
| PDZ | 728..816 | CDD:214570 | |||
| PDZ_signaling | 931..1016 | CDD:238492 | |||
| PDZ | 1239..1329 | CDD:214570 | |||
| PDZ_signaling | 1336..1425 | CDD:238492 | |||
| ppp1r7 | NP_001032463.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..53 | ||
| LRR 1 | 62..83 | 6/18 (33%) | |||
| LRR 2 | 84..105 | 5/24 (21%) | |||
| LRR_8 | 86..139 | CDD:290566 | 21/61 (34%) | ||
| LRR_4 | 86..124 | CDD:289563 | 14/42 (33%) | ||
| leucine-rich repeat | 86..106 | CDD:275380 | 6/23 (26%) | ||
| LRR_4 | 106..147 | CDD:289563 | 17/45 (38%) | ||
| LRR 3 | 106..127 | 9/21 (43%) | |||
| leucine-rich repeat | 107..128 | CDD:275380 | 9/21 (43%) | ||
| LRR_4 | 127..169 | CDD:289563 | 15/66 (23%) | ||
| LRR 4 | 128..149 | 10/41 (24%) | |||
| leucine-rich repeat | 129..150 | CDD:275380 | 10/41 (24%) | ||
| LRR 5 | 150..171 | 5/24 (21%) | |||
| leucine-rich repeat | 151..172 | CDD:275380 | 6/24 (25%) | ||
| LRR 6 | 172..193 | 6/21 (29%) | |||
| leucine-rich repeat | 173..216 | CDD:275380 | 18/67 (27%) | ||
| LRR 7 | 194..215 | 9/24 (38%) | |||
| LRR_8 | 216..271 | CDD:290566 | 17/56 (30%) | ||
| LRR_4 | 216..257 | CDD:289563 | 14/42 (33%) | ||
| LRR 8 | 216..237 | 6/21 (29%) | |||
| leucine-rich repeat | 217..238 | CDD:275380 | 7/21 (33%) | ||
| LRR_4 | 238..279 | CDD:289563 | 10/42 (24%) | ||
| LRR 9 | 238..259 | 6/21 (29%) | |||
| leucine-rich repeat | 239..260 | CDD:275380 | 6/21 (29%) | ||
| LRR_4 | 259..301 | CDD:289563 | 7/42 (17%) | ||
| LRR 10 | 260..281 | 4/21 (19%) | |||
| leucine-rich repeat | 261..282 | CDD:275380 | 4/21 (19%) | ||
| LRR 11 | 282..303 | 4/20 (20%) | |||
| leucine-rich repeat | 283..307 | CDD:275380 | 5/23 (22%) | ||
| LRRcap | 321..339 | CDD:197729 | 1/2 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||