DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and lingo4b

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001082850.1 Gene:lingo4b / 559074 ZFINID:ZDB-GENE-091214-3 Length:604 Species:Danio rerio


Alignment Length:525 Identity:134/525 - (25%)
Similarity:208/525 - (39%) Gaps:81/525 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CNRQVEFVD--KRHCSLPQVPEEILRYSRTLEELFLDANHIRDLP-KNFFRLHRLRKLGLSDNEI 72
            |:|....|:  .||  |..|||.:...::.|:   |..|.::.|. :.|..|.:|..|.||:|.|
Zfish    35 CSRDPLEVNCSSRH--LTAVPEGLPTNAKRLD---LSGNQLKTLARRQFSSLSKLEDLDLSENII 94

  Fly    73 GRLPPDIQNFE---------------------------NLVELDVSRNDIPDIPD-DIKHLQSLQ 109
            ..:  :::.|:                           ||..||:|.|:|....| ..:.:.:||
Zfish    95 SMI--EVETFQGLKNLRYLRIKNNRLKILPVGVFSGLSNLRRLDISENEILVFLDYTFRDMINLQ 157

  Fly   110 VADFSSNPIPKLPS-GFSQLKNLTVLGLNDMSLTTLPADFGSLTQLES---LELRENLLKHLPET 170
            ..|...|.:..:.. .|..|:.|..|.::..:||::|.:  :|:||:|   |.||:..:..||..
Zfish   158 QLDAGENDLVFISQRAFVGLQALKELNVDRSNLTSIPTE--ALSQLQSLTKLRLRKLTISVLPNN 220

  Fly   171 ----ISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLP-PELGLLTKLTYLDVSE 230
                :.||..|:.|.....|:.:....:|.  .|..|.|.:..|..:| ..|..|..|.|||:|.
Zfish   221 AFRRLHQLRTLQILHWSSLEMLNSNSLVGL--NLTTLVLTNCNLSAIPYSPLRHLAYLQYLDLSY 283

  Fly   231 NRLEELPNEISG-LVSLTDLDL-AQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDT-LGNCENM 292
            |.:..:...:.| |:.|.:|.| ..|||...|.....|||..:|.:..|||..|.:: ..:..|:
Zfish   284 NPITSIQGNLLGDLLRLQELHLVGGNLLRIEPGAFRGLSRFRLLNVSSNRLSTLEESAFHSVGNL 348

  Fly   293 QELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGN 357
            |.|.|..|.|:.....:..|.:...|:.|.......||      |....:.||....:| |.:..
Zfish   349 QTLRLDRNPLACDCRLLWVMRRRRRLDFDGRQPTCSPL------NHQRKAFRDFSEAEL-PVVFT 406

  Fly   358 CTVLHVLDVSGNQLLYLPYSLVNLQLKA--------VWLSENQSQPLLTFQPDTDAETGEQVLSC 414
            |....:|:.....:..:....|:...||        .|||..||  .|:........|...:...
Zfish   407 CRQAQILNRQLQDISVIEGMRVHFDCKADGYPSPSITWLSAQQS--ALSSAGRVRVLTNGSLQIS 469

  Fly   415 YLLPQQEYQPITPA-----RDLESDSEPFEEREPSRTVVKFSEEATQEKETP-----FVRQNTPH 469
            |...|.....:..|     .|..|.|...|....:|||..||:|...|...|     ..|.::|:
Zfish   470 YAQVQDSGTYLCSAANAAGNDSISVSLHVEGLPQNRTVSYFSDEGWIETSAPPSTNSSARVSSPY 534

  Fly   470 PKDLK 474
            |.|.|
Zfish   535 PFDAK 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 84/311 (27%)
leucine-rich repeat 18..38 CDD:275380 7/21 (33%)
LRR_8 37..95 CDD:290566 19/85 (22%)
leucine-rich repeat 39..61 CDD:275380 6/22 (27%)
leucine-rich repeat 62..84 CDD:275380 7/48 (15%)
LRR_8 84..138 CDD:290566 16/55 (29%)
leucine-rich repeat 85..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..130 CDD:275380 6/22 (27%)
LRR_8 129..187 CDD:290566 18/64 (28%)
leucine-rich repeat 131..153 CDD:275380 6/21 (29%)
leucine-rich repeat 154..176 CDD:275380 9/28 (32%)
leucine-rich repeat 177..199 CDD:275380 4/21 (19%)
LRR_8 198..256 CDD:290566 19/60 (32%)
leucine-rich repeat 200..222 CDD:275380 7/22 (32%)
leucine-rich repeat 223..245 CDD:275380 8/22 (36%)
LRR_8 267..325 CDD:290566 16/58 (28%)
leucine-rich repeat 269..289 CDD:275380 5/20 (25%)
leucine-rich repeat 292..314 CDD:275380 6/21 (29%)
leucine-rich repeat 315..337 CDD:275380 4/21 (19%)
LRR_4 337..375 CDD:289563 7/37 (19%)
leucine-rich repeat 361..382 CDD:275380 2/20 (10%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
lingo4bNP_001082850.1 LRRNT 28..61 CDD:214470 9/27 (33%)
leucine-rich repeat 41..62 CDD:275380 7/22 (32%)
LRR <56..304 CDD:227223 63/256 (25%)
leucine-rich repeat 63..83 CDD:275380 6/22 (27%)
leucine-rich repeat 84..107 CDD:275380 7/24 (29%)
leucine-rich repeat 108..131 CDD:275380 0/22 (0%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
leucine-rich repeat 180..203 CDD:275380 8/24 (33%)
leucine-rich repeat 204..251 CDD:275380 11/48 (23%)
leucine-rich repeat 228..250 CDD:275380 4/21 (19%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
leucine-rich repeat 276..297 CDD:275380 7/20 (35%)
LRR_8 299..358 CDD:316378 20/58 (34%)
leucine-rich repeat 300..321 CDD:275380 7/20 (35%)
leucine-rich repeat 324..344 CDD:275380 5/19 (26%)
I-set 415..498 CDD:254352 16/84 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.