DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and lrrc28

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001005442.1 Gene:lrrc28 / 448029 XenbaseID:XB-GENE-957286 Length:367 Species:Xenopus tropicalis


Alignment Length:306 Identity:94/306 - (30%)
Similarity:133/306 - (43%) Gaps:61/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KNLTVLGLNDMSLTTLPADF---GSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDL 190
            |||.   ||..:|...|.:.   ..|..||.|.::.|.|..|||.::|                 
 Frog    18 KNLF---LNYRNLNHFPLELLKDEGLQYLERLYMKRNSLTTLPENLAQ----------------- 62

  Fly   191 PPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNL 255
                 .||.|.||:|..|.:..:|..:|.|.||..||:|.|.||.|..:|..|.||..|.|..|.
 Frog    63 -----KLPNLVELYLHSNNIVFVPEAIGSLVKLQSLDLSNNALEILCPDIGRLKSLRHLRLTNNR 122

  Fly   256 LEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNV 320
            |:.||..|.||..|..|.|..|.|..|.:.|..|:::|.|.:..|.|..:|..:.|:..||.|::
 Frog   123 LKFLPPEIGKLKELQTLDLSTNHLVSLPEKLYQCQSLQYLTVDRNLLCSIPRQLCQLASLNELSM 187

  Fly   321 DRNALEYLPLEIGQCANLGVLSLRDN-KLKKLPPELGNCTVLHVLDVSG---------NQLLYLP 375
            ..|.|..|||::|:...|..:.:.:| :||.||..|.|    .|:..||         |:||...
 Frog   188 AGNRLASLPLDLGRSRELQYVYVDNNVQLKGLPSYLYN----KVIGCSGCGSPVPLTENKLLSFT 248

  Fly   376 YSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQE 421
            ...:::.:.|...|...:         ||          ::||.||
 Frog   249 SGQLSIHVPAEVKSIGSA---------TD----------FVLPLQE 275

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 54/156 (35%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380
LRR_8 84..138 CDD:290566 4/8 (50%)
leucine-rich repeat 85..107 CDD:275380