DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and chp

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster


Alignment Length:598 Identity:152/598 - (25%)
Similarity:244/598 - (40%) Gaps:121/598 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PEEILRYSRTLEELFLDANHIRDLPKNFFR-LHRLRKLGLSDNEIGRLPPDI--QNFENLVELDV 90
            ||:...:...||:|.:....:..:..:.|: :..|::|..|:|.|..:..|.  :...:|:.|.:
  Fly   441 PEDFKDFGVELEDLQITRASLSGIQSHAFKHVRGLKRLDFSENGISSIENDAFHEIGHSLISLKM 505

  Fly    91 SR----NDIPDIPDDIKHLQSLQVADFSSNPIPKL-PSGFSQLKNLTVLGLNDMSLT-----TLP 145
            |.    :.:|..|  ::||.|||..|||:|.|..: .:.|..||||.:|.|:|..:.     |..
  Fly   506 SHGYSGSALPAEP--LRHLTSLQELDFSNNHISSMSDTSFHFLKNLRLLELHDNRIEQVLKGTFQ 568

  Fly   146 ADFGSLTQLESLELRENLLKHLPE-TISQLTKLKRLDLGDNEIE----------DLPPYLGY--- 196
            .|..|  :||.:.||.|.|..:.: |...|..|::|.|.||:|:          |...||..   
  Fly   569 GDIHS--KLEEISLRFNHLTSISQHTFFDLEALRKLHLDDNKIDKIERRAFMNLDELEYLSLRGN 631

  Fly   197 ------------LPGLHELWLDHNQLQRLP----PELGLLTKLTYLDVSENRLEEL--------P 237
                        ||.|..|.:..|||....    .::|.|:.|. ::||.|::.:|        .
  Fly   632 KINNLADESFQNLPKLEILDMAFNQLPNFNFDYFDQVGTLSNLN-VNVSHNQIRQLMYNSSWSGR 695

  Fly   238 NEISGLV--SLTDLDLAQNLLEALPDGI---AKLSRLTILKLDQNRLQR-LNDTLGNCENMQELI 296
            ||..|:.  ::..|||:.|.:..:..|.   |::| ||.|.|..|.|.. ..|..||..::|.|.
  Fly   696 NEHGGMYHSNIKILDLSHNNISIIHPGYFRPAEIS-LTHLHLGYNSLMNTTRDVFGNMPHLQWLD 759

  Fly   297 LTENFLSELPASIGQMTK-LNNLNVDRNALEYLPLEIGQ-CANLGVLSLRDNKLKKLPPELGNCT 359
            |:.|::.||.....:.|| |..:....|.|..:|.:|.: ...|.::....|.|:.||..|....
  Fly   760 LSYNWIHELDFDAFKNTKQLQLVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRGLPDNLFYNG 824

  Fly   360 VLHVLDVSGNQLLYLP----YSLVNLQLKAVWLSEN--------------QSQPLLTFQPDTDAE 406
            .:..||||.|.:|.:|    .||..|.|..:.||.|              :|...|....:....
  Fly   825 GMEKLDVSHNMMLKIPSSSLSSLAALTLCELHLSNNFISTIHSMDLSNKFRSLRYLDISYNYLLR 889

  Fly   407 TGEQVLSCYLLPQQEYQPITPARDLESDSEPFEEREPSRTVVKFSEEATQEKETPFVRQNTPHPK 471
            ..:.|.:  .:|:.....::..|||:...:.|...|.|  ::|...|.......|.:|       
  Fly   890 IDDAVFA--TMPKLAVLDLSHNRDLKVMDKSFMGLENS--LIKLGLENISLSTVPEIR------- 943

  Fly   472 DLKAKAQKLKVERSRNEEHANLVTLPEENGTKLAETPTETR--TIANNH--------QQQPHPVQ 526
                    ||..|.....:..|.::|:|    ||...:..|  .::||.        |..||..:
  Fly   944 --------LKYLREFRLGYNELPSIPQE----LAHNMSNLRMLDLSNNDLTNVPLMTQALPHLRR 996

  Fly   527 -----QPIVGVNS 534
                 .||..:|:
  Fly   997 LMLSGNPITSLNN 1009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 85/310 (27%)
leucine-rich repeat 18..38 CDD:275380 2/8 (25%)
LRR_8 37..95 CDD:290566 13/64 (20%)
leucine-rich repeat 39..61 CDD:275380 4/22 (18%)
leucine-rich repeat 62..84 CDD:275380 6/23 (26%)
LRR_8 84..138 CDD:290566 22/58 (38%)
leucine-rich repeat 85..107 CDD:275380 7/25 (28%)
leucine-rich repeat 108..130 CDD:275380 9/22 (41%)
LRR_8 129..187 CDD:290566 22/63 (35%)
leucine-rich repeat 131..153 CDD:275380 7/26 (27%)
leucine-rich repeat 154..176 CDD:275380 8/22 (36%)
leucine-rich repeat 177..199 CDD:275380 10/46 (22%)
LRR_8 198..256 CDD:290566 20/71 (28%)
leucine-rich repeat 200..222 CDD:275380 7/25 (28%)
leucine-rich repeat 223..245 CDD:275380 8/31 (26%)
LRR_8 267..325 CDD:290566 20/59 (34%)
leucine-rich repeat 269..289 CDD:275380 8/20 (40%)
leucine-rich repeat 292..314 CDD:275380 6/21 (29%)
leucine-rich repeat 315..337 CDD:275380 5/22 (23%)
LRR_4 337..375 CDD:289563 12/37 (32%)
leucine-rich repeat 361..382 CDD:275380 9/24 (38%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380
LRR_8 102..163 CDD:290566
leucine-rich repeat 104..128 CDD:275380
LRR_RI <128..261 CDD:238064
leucine-rich repeat 129..152 CDD:275380
LRR_8 152..212 CDD:290566
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR_8 202..261 CDD:290566
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
LRR_8 326..386 CDD:290566
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378 2/8 (25%)
LRR_RI <448..651 CDD:238064 56/206 (27%)
leucine-rich repeat 451..474 CDD:275380 4/22 (18%)
LRR_8 473..559 CDD:290566 29/87 (33%)
leucine-rich repeat 475..524 CDD:275380 13/50 (26%)
leucine-rich repeat 500..519 CDD:275380 5/20 (25%)
leucine-rich repeat 525..548 CDD:275380 9/22 (41%)
leucine-rich repeat 549..574 CDD:275380 7/26 (27%)
LRR_8 573..633 CDD:290566 18/61 (30%)
leucine-rich repeat 575..598 CDD:275380 8/22 (36%)
leucine-rich repeat 599..622 CDD:275380 6/22 (27%)
LRR_8 622..683 CDD:290566 15/61 (25%)
leucine-rich repeat 623..646 CDD:275380 3/22 (14%)
leucine-rich repeat 647..730 CDD:275380 21/83 (25%)
leucine-rich repeat 648..673 CDD:275380 6/24 (25%)
leucine-rich repeat 674..705 CDD:275380 8/31 (26%)
LRR_8 704..763 CDD:290566 19/59 (32%)
leucine-rich repeat 731..754 CDD:275380 9/22 (41%)
LRR_8 753..813 CDD:290566 15/59 (25%)
leucine-rich repeat 755..778 CDD:275380 7/22 (32%)
leucine-rich repeat 779..802 CDD:275380 5/22 (23%)
leucine-rich repeat 803..823 CDD:275380 6/19 (32%)
leucine-rich repeat 852..876 CDD:275380 4/23 (17%)
LRR_8 854..910 CDD:290566 7/57 (12%)
LRR_RI <877..>1006 CDD:238064 29/151 (19%)
leucine-rich repeat 877..900 CDD:275380 2/24 (8%)
leucine-rich repeat 901..925 CDD:275380 5/23 (22%)
leucine-rich repeat 926..946 CDD:275380 5/34 (15%)
LRR_8 947..1004 CDD:290566 12/60 (20%)
leucine-rich repeat 947..970 CDD:275380 6/26 (23%)
leucine-rich repeat 971..993 CDD:275380 4/21 (19%)
LRR_8 992..1049 CDD:290566 5/18 (28%)
leucine-rich repeat 994..1014 CDD:275380 3/16 (19%)
leucine-rich repeat 1019..1042 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.