DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and LRCH4

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_002310.2 Gene:LRCH4 / 4034 HGNCID:6691 Length:683 Species:Homo sapiens


Alignment Length:803 Identity:185/803 - (23%)
Similarity:275/803 - (34%) Gaps:255/803 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IKH----------LQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLES 156
            :||          |..:..||.|.|..|::|....|                       |..||.
Human    54 LKHFPRGAARSYDLSDITQADLSRNRFPEVPEAACQ-----------------------LVSLEG 95

  Fly   157 LELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLT 221
            |.|..|.|:.|...:..||.|..|:|..|::..||||:..|| |..|.:.:|:|..|||::|.|.
Human    96 LSLYHNCLRCLNPALGNLTALTYLNLSRNQLSLLPPYICQLP-LRVLIVSNNKLGALPPDIGTLG 159

  Fly   222 KLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLD--QNRLQRLND 284
            .|..||||.|.|:.||:|:.||.||.||::.:|.|..||:   :|..|.:::||  .||:.|:..
Human   160 SLRQLDVSSNELQSLPSELCGLSSLRDLNVRRNQLSTLPE---ELGDLPLVRLDFSCNRVSRIPV 221

  Fly   285 TLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCAN-LGVLSLRDNKL 348
            :.....::|.::|..|.|...||.:....||       :..:||..|.||..: ||.|:      
Human   222 SFCRLRHLQVILLDSNPLQSPPAQVCLKGKL-------HIFKYLSTEAGQRGSALGDLA------ 273

  Fly   349 KKLPPELGNCTV----------------LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLL 397
            ...||....|..                .|.:| ||::.               | |.|:|    
Human   274 PSRPPSFSPCPAEDLFPGHRYDGGLDSGFHSVD-SGSKR---------------W-SGNES---- 317

  Fly   398 TFQPDTDAETGEQVLSCYLLPQQEYQPITPARDLESDSEPFE----------EREPSRTV----- 447
                 || |..|.......|.::...|.....|..:|.:|.:          |.|...||     
Human   318 -----TD-EFSELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSHVPGEDEERGTVEEQRP 376

  Fly   448 VKFSEEATQEKETPFVRQNTPHPKDLKAKAQKLKV--ERSRNEEH-------------------- 490
            .:.|..|...:..|..|:..|..:: :.:...|::  ||.|.::.                    
Human   377 PELSPGAGDRERAPSSRREEPAGEE-RRRPDTLQLWQERERRQQQQSGAWGAPRKDSLLKPGLRA 440

  Fly   491 -----ANLVTLPEENGTKLAETPTETRTIANNHQQQPHPVQQ---PIVG-VNSKQPVVVGVVTPT 546
                 |.:.|....||:. ..:.::....|......|.|..|   ||.| ..:..|..:|.:...
Human   441 VVGGAAAVSTQAMHNGSP-KSSASQAGAAAGQGAPAPAPASQEPLPIAGPATAPAPRPLGSIQRP 504

  Fly   547 TTTVAPTGVQGGSEGASSTANNVKAATAAVVAELAATVGGSDEVQDDDEQEDEFESDRRVGFQVE 611
            .:.:..:..|.|| |.||                                .|.....||.. ||.
Human   505 NSFLFRSSSQSGS-GPSS--------------------------------PDSVLRPRRYP-QVP 535

  Fly   612 GEDDDFYKRPPKLHRRDTPHHLKNKRVQHLTDKQASEILANALASQERNDTTP-QHSLSGKVTSP 675
            .|.|...:....|..|     |:....:.|.:..||.::...||:|.|..:.| .|     |.||
Human   536 DEKDLMTQLRQVLESR-----LQRPLPEDLAEALASGVILCQLANQLRPRSVPFIH-----VPSP 590

  Fly   676 IEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAEASTDPDNLDGVTELRLEQYEIHIERTAAG 740
            ...:                     ||.:.|.|..|:..:.....||.|..|......::.||.|
Human   591 AVPK---------------------LSALKARKNVESFLEACRKMGVPEADLCSPSDLLQGTARG 634

  Fly   741 LGLSI-----AGGKGSTPFKGDDDGIFISRVTEAGPADLAGLKVGDKVIKVNGIVVVDADHYQAV 800
            |..::     .|||...|.              ..|:.|.|..|                .|   
Human   635 LRTALEAVKRVGGKALPPL--------------WPPSGLGGFVV----------------FY--- 666

  Fly   801 QVLKACGAVLVLVVQREVTRLIG 823
                   .||:|::....|||:|
Human   667 -------VVLMLLLYVTYTRLLG 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 66/192 (34%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380
LRR_8 84..138 CDD:290566 10/45 (22%)
leucine-rich repeat 85..107 CDD:275380 3/14 (21%)
leucine-rich repeat 108..130 CDD:275380 7/21 (33%)
LRR_8 129..187 CDD:290566 14/57 (25%)
leucine-rich repeat 131..153 CDD:275380 1/21 (5%)
leucine-rich repeat 154..176 CDD:275380 8/21 (38%)
leucine-rich repeat 177..199 CDD:275380 9/21 (43%)
LRR_8 198..256 CDD:290566 27/57 (47%)
leucine-rich repeat 200..222 CDD:275380 9/21 (43%)
leucine-rich repeat 223..245 CDD:275380 12/21 (57%)
LRR_8 267..325 CDD:290566 14/59 (24%)
leucine-rich repeat 269..289 CDD:275380 6/21 (29%)
leucine-rich repeat 292..314 CDD:275380 6/21 (29%)
leucine-rich repeat 315..337 CDD:275380 6/21 (29%)
LRR_4 337..375 CDD:289563 10/54 (19%)
leucine-rich repeat 361..382 CDD:275380 4/20 (20%)
PDZ 728..816 CDD:214570 16/92 (17%)
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
LRCH4NP_002310.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
LRR 1 43..64 2/9 (22%)
leucine-rich repeat 46..69 CDD:275380 3/14 (21%)
LRR 2 69..90 7/43 (16%)
leucine-rich repeat 70..92 CDD:275380 8/44 (18%)
LRR_8 92..148 CDD:290566 22/56 (39%)
LRR_4 92..131 CDD:289563 14/38 (37%)
LRR 3 92..114 7/21 (33%)
leucine-rich repeat 93..115 CDD:275380 8/21 (38%)
LRR_RI <103..>245 CDD:238064 55/145 (38%)
LRR 4 115..136 8/20 (40%)
leucine-rich repeat 116..131 CDD:275380 5/14 (36%)
LRR 5 137..158 9/21 (43%)
LRR_8 138..194 CDD:290566 26/55 (47%)
leucine-rich repeat 138..160 CDD:275380 9/21 (43%)
LRR 6 160..182 11/21 (52%)
leucine-rich repeat 161..183 CDD:275380 12/21 (57%)
LRR_8 182..239 CDD:290566 18/59 (31%)
LRR 7 183..205 9/24 (38%)
leucine-rich repeat 184..204 CDD:275380 8/22 (36%)
leucine-rich repeat 206..228 CDD:275380 5/21 (24%)
LRR 8 206..226 5/19 (26%)
LRR 9 228..249 6/20 (30%)
leucine-rich repeat 229..247 CDD:275380 6/17 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..292 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..436 18/110 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..539 24/124 (19%)
CH 537..627 CDD:278723 26/120 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.