DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and lrr1

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_989278.1 Gene:lrr1 / 394892 XenbaseID:XB-GENE-1006187 Length:418 Species:Xenopus tropicalis


Alignment Length:308 Identity:88/308 - (28%)
Similarity:128/308 - (41%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHL-PETISQLTKLKRLDLGDNEIED 189
            |.|||.    ::.:.|....||.|::           ||..| |...|::.| .|..:.....:|
 Frog    95 SSLKNF----ISAVGLANKGADIGTV-----------LLPRLTPAKTSEIEK-PRAKMFITTKKD 143

  Fly   190 LPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQN 254
            .|....:...|..|.:.:.:|.|:...:..|.||..||:|.|.:::||..|..||.|.:|.|..|
 Frog   144 YPITKSFPYSLEHLQVSYCKLARVDMRMLCLKKLQKLDLSNNHIKKLPKTIGDLVCLQELILNNN 208

  Fly   255 LLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLN 319
            |||:....:...:              |.|||      :.|.|:.|.|..||..|....:|.:|.
 Frog   209 LLESFEVVLCSTT--------------LRDTL------KSLDLSANKLKALPVQICNFKELVSLK 253

  Fly   320 VDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNLQLK 384
            :|.|.|..||..|||.:.|..||...|||:.||......: |..||:.||..:.....:.::|||
 Frog   254 LDENELLQLPFPIGQLSKLRFLSATKNKLQCLPNTFKKLS-LEKLDLFGNPFIQATPLVPDIQLK 317

  Fly   385 AVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQEYQ-PITPARDL 431
            .       ..|||        ||..:....|.:|...:. |.|..:||
 Frog   318 I-------PLPLL--------ETATRATLNYRIPYGPHLIPATLCQDL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 40/157 (25%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380
LRR_8 84..138 CDD:290566 4/11 (36%)
leucine-rich repeat 85..107 CDD:275380
leucine-rich repeat 108..130 CDD:275380 2/3 (67%)
LRR_8 129..187 CDD:290566 13/58 (22%)
leucine-rich repeat 131..153 CDD:275380 4/21 (19%)
leucine-rich repeat 154..176 CDD:275380 5/22 (23%)
leucine-rich repeat 177..199 CDD:275380 3/21 (14%)
LRR_8 198..256 CDD:290566 20/57 (35%)
leucine-rich repeat 200..222 CDD:275380 5/21 (24%)
leucine-rich repeat 223..245 CDD:275380 9/21 (43%)
LRR_8 267..325 CDD:290566 15/57 (26%)
leucine-rich repeat 269..289 CDD:275380 4/19 (21%)
leucine-rich repeat 292..314 CDD:275380 7/21 (33%)
leucine-rich repeat 315..337 CDD:275380 10/21 (48%)
LRR_4 337..375 CDD:289563 13/37 (35%)
leucine-rich repeat 361..382 CDD:275380 5/20 (25%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
lrr1NP_989278.1 LRR <145..>310 CDD:227223 58/185 (31%)
leucine-rich repeat 154..176 CDD:275380 5/21 (24%)
leucine-rich repeat 177..199 CDD:275380 9/21 (43%)
leucine-rich repeat 200..225 CDD:275380 8/38 (21%)
leucine-rich repeat 226..248 CDD:275380 8/27 (30%)
leucine-rich repeat 249..271 CDD:275380 10/21 (48%)
leucine-rich repeat 272..293 CDD:275380 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.