DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and CG3408

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_648328.1 Gene:CG3408 / 39107 FlyBaseID:FBgn0036008 Length:331 Species:Drosophila melanogaster


Alignment Length:108 Identity:41/108 - (37%)
Similarity:60/108 - (55%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ENLVE--LDVSRNDIPDIP-DDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTL 144
            |.:|:  .|:|.:::.:|| .:|...:.:.|.|.|||.:..|...||.|..|..|.|:...:..|
  Fly    16 ERVVDETCDLSLSELSEIPVREIASFKRVTVLDLSSNRLVNLGKNFSILTRLVRLDLSKNQIKFL 80

  Fly   145 PADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEI 187
            |.|||.|.||..|:|..|.|:|||.:..||.:|:.|||..|.:
  Fly    81 PEDFGQLEQLRHLDLYNNCLEHLPISFGQLRRLRYLDLKGNPL 123

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 41/108 (38%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566 4/13 (31%)
leucine-rich repeat 39..61 CDD:275380