DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and ics

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001285902.1 Gene:ics / 34774 FlyBaseID:FBgn0028546 Length:283 Species:Drosophila melanogaster


Alignment Length:237 Identity:72/237 - (30%)
Similarity:124/237 - (52%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CIPIFKGCNRQVEFVDK-RHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRKLGL 67
            |||:....::..:.:|: |....|::         .|.:..|.:  ..:|| ..|.:..:.:|.|
  Fly     5 CIPVSAKMSKAKKVLDEARETHNPEL---------DLADKGLSS--FEELP-GLFNMSNITRLTL 57

  Fly    68 SDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLT 132
            |.|:|..:.|.|.|..||..|::|.|.:.::|..:..:..|::.:.|.|.:..||.||.....|.
  Fly    58 SHNKISVISPGIANLLNLEILNLSNNQLTELPVSLSSMPKLRILNVSINRLINLPRGFGAFPVLE 122

  Fly   133 VLGL--NDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLG 195
            ||.|  |:::...||.:|..:..|.:|.|.:|..:::|:.:.||..|:.|.|.||::.:||..:|
  Fly   123 VLDLSYNNLNEQVLPGNFFGMETLRALYLGDNDFEYIPKEVGQLKNLQILGLRDNDLLELPREVG 187

  Fly   196 YLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELP 237
            .|..|.||.:.:|:||.||||:..|..|:  :.|..::||.|
  Fly   188 DLVRLRELHIQNNRLQVLPPEIAQLDLLS--NKSVMKMEENP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 69/228 (30%)
leucine-rich repeat 18..38 CDD:275380 3/20 (15%)
LRR_8 37..95 CDD:290566 18/57 (32%)
leucine-rich repeat 39..61 CDD:275380 5/21 (24%)
leucine-rich repeat 62..84 CDD:275380 8/21 (38%)
LRR_8 84..138 CDD:290566 17/55 (31%)
leucine-rich repeat 85..107 CDD:275380 5/21 (24%)
leucine-rich repeat 108..130 CDD:275380 7/21 (33%)
LRR_8 129..187 CDD:290566 20/59 (34%)
leucine-rich repeat 131..153 CDD:275380 8/23 (35%)
leucine-rich repeat 154..176 CDD:275380 7/21 (33%)
leucine-rich repeat 177..199 CDD:275380 9/21 (43%)
LRR_8 198..256 CDD:290566 16/40 (40%)
leucine-rich repeat 200..222 CDD:275380 11/21 (52%)
leucine-rich repeat 223..245 CDD:275380 5/15 (33%)
LRR_8 267..325 CDD:290566
leucine-rich repeat 269..289 CDD:275380
leucine-rich repeat 292..314 CDD:275380
leucine-rich repeat 315..337 CDD:275380
LRR_4 337..375 CDD:289563
leucine-rich repeat 361..382 CDD:275380
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
icsNP_001285902.1 leucine-rich repeat 29..51 CDD:275380 5/33 (15%)
leucine-rich repeat 52..84 CDD:275380 12/31 (39%)
LRR_8 96..156 CDD:290566 19/59 (32%)
leucine-rich repeat 98..120 CDD:275380 7/21 (33%)
LRR 119..>222 CDD:227223 37/104 (36%)
leucine-rich repeat 121..145 CDD:275380 8/23 (35%)
leucine-rich repeat 146..168 CDD:275380 7/21 (33%)
leucine-rich repeat 169..191 CDD:275380 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.