Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956211.1 | Gene: | synj2bp / 334599 | ZFINID: | ZDB-GENE-030131-6531 | Length: | 152 | Species: | Danio rerio |
Alignment Length: | 135 | Identity: | 40/135 - (29%) |
---|---|---|---|
Similarity: | 64/135 - (47%) | Gaps: | 25/135 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1317 PGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAA 1381
Fly 1382 RRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLIHSIGQAGGMSTG 1446
Fly 1447 FNSSA 1451 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |