Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956156.2 | Gene: | lrrc40 / 334130 | ZFINID: | ZDB-GENE-030131-6062 | Length: | 601 | Species: | Danio rerio |
Alignment Length: | 592 | Identity: | 143/592 - (24%) |
---|---|---|---|
Similarity: | 239/592 - (40%) | Gaps: | 152/592 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 DKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH----------------------- 60
Fly 61 RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGF 125
Fly 126 SQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDL 190
Fly 191 PPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNL 255
Fly 256 LEAL-PDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLN 319
Fly 320 VDRN----------------ALEYLPLEIGQCANLG----------------------------- 339
Fly 340 --------------------------------------VLSLRD---------NKLKKLPPELGN 357
Fly 358 CTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWLSEN--QSQPLLTFQ-P--DTDAETGEQV----- 411
Fly 412 --------LSCYLLPQQEYQPITP-------ARDLESDSEPFEEREPSRTVVKFSEEATQEKETP 461
Fly 462 FVRQNTP 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scrib | NP_001163746.1 | LRR_RI | 13..283 | CDD:238064 | 85/287 (30%) |
leucine-rich repeat | 18..38 | CDD:275380 | 5/18 (28%) | ||
LRR_8 | 37..95 | CDD:290566 | 19/80 (24%) | ||
leucine-rich repeat | 39..61 | CDD:275380 | 5/44 (11%) | ||
leucine-rich repeat | 62..84 | CDD:275380 | 8/21 (38%) | ||
LRR_8 | 84..138 | CDD:290566 | 22/53 (42%) | ||
leucine-rich repeat | 85..107 | CDD:275380 | 9/21 (43%) | ||
leucine-rich repeat | 108..130 | CDD:275380 | 9/21 (43%) | ||
LRR_8 | 129..187 | CDD:290566 | 21/57 (37%) | ||
leucine-rich repeat | 131..153 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 154..176 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 177..199 | CDD:275380 | 8/21 (38%) | ||
LRR_8 | 198..256 | CDD:290566 | 17/57 (30%) | ||
leucine-rich repeat | 200..222 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 223..245 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 267..325 | CDD:290566 | 17/73 (23%) | ||
leucine-rich repeat | 269..289 | CDD:275380 | 5/19 (26%) | ||
leucine-rich repeat | 292..314 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 315..337 | CDD:275380 | 6/37 (16%) | ||
LRR_4 | 337..375 | CDD:289563 | 12/113 (11%) | ||
leucine-rich repeat | 361..382 | CDD:275380 | 8/21 (38%) | ||
PDZ | 728..816 | CDD:214570 | |||
PDZ_signaling | 931..1016 | CDD:238492 | |||
PDZ | 1239..1329 | CDD:214570 | |||
PDZ_signaling | 1336..1425 | CDD:238492 | |||
lrrc40 | NP_956156.2 | LRR 1 | 33..56 | 4/22 (18%) | |
LRR 2 | 79..101 | 8/21 (38%) | |||
LRR_8 | 82..138 | CDD:290566 | 21/55 (38%) | ||
leucine-rich repeat | 82..104 | CDD:275380 | 8/21 (38%) | ||
LRR_RI | 99..343 | CDD:238064 | 78/244 (32%) | ||
LRR 3 | 102..124 | 8/21 (38%) | |||
leucine-rich repeat | 105..127 | CDD:275380 | 9/21 (43%) | ||
LRR 4 | 125..148 | 9/22 (41%) | |||
LRR_8 | 127..184 | CDD:290566 | 21/56 (38%) | ||
leucine-rich repeat | 128..150 | CDD:275380 | 9/21 (43%) | ||
LRR 5 | 150..170 | 6/19 (32%) | |||
leucine-rich repeat | 151..173 | CDD:275380 | 7/21 (33%) | ||
LRR 6 | 171..193 | 8/21 (38%) | |||
leucine-rich repeat | 174..196 | CDD:275380 | 8/21 (38%) | ||
LRR 7 | 194..217 | 9/22 (41%) | |||
LRR_8 | 196..253 | CDD:290566 | 18/56 (32%) | ||
leucine-rich repeat | 197..219 | CDD:275380 | 8/21 (38%) | ||
LRR 8 | 219..239 | 7/19 (37%) | |||
leucine-rich repeat | 220..242 | CDD:275380 | 7/21 (33%) | ||
LRR 9 | 240..264 | 7/24 (29%) | |||
leucine-rich repeat | 243..288 | CDD:275380 | 13/45 (29%) | ||
LRR_8 | 263..322 | CDD:290566 | 15/58 (26%) | ||
LRR 10 | 266..285 | 4/18 (22%) | |||
LRR 11 | 286..308 | 6/21 (29%) | |||
leucine-rich repeat | 289..311 | CDD:275380 | 5/21 (24%) | ||
LRR 12 | 309..334 | 8/24 (33%) | |||
leucine-rich repeat | 335..354 | CDD:275380 | 3/18 (17%) | ||
LRR 13 | 336..355 | 2/18 (11%) | |||
LRR 14 | 397..420 | 0/22 (0%) | |||
leucine-rich repeat | 400..449 | CDD:275380 | 1/48 (2%) | ||
LRR 15 | 423..446 | 0/22 (0%) | |||
LRR 16 | 447..469 | 5/21 (24%) | |||
LRR_8 | 449..506 | CDD:290566 | 17/56 (30%) | ||
leucine-rich repeat | 450..472 | CDD:275380 | 4/21 (19%) | ||
LRR 17 | 470..492 | 7/21 (33%) | |||
leucine-rich repeat | 473..495 | CDD:275380 | 8/21 (38%) | ||
LRR 18 | 493..516 | 8/22 (36%) | |||
leucine-rich repeat | 496..518 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 517..576 | CDD:290566 | 11/58 (19%) | ||
LRR 19 | 518..539 | 3/20 (15%) | |||
leucine-rich repeat | 519..542 | CDD:275380 | 3/22 (14%) | ||
LRR 20 | 540..563 | 4/22 (18%) | |||
leucine-rich repeat | 543..565 | CDD:275380 | 4/21 (19%) | ||
LRR 21 | 565..586 | 7/22 (32%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |