DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and CG32687

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001259412.1 Gene:CG32687 / 31980 FlyBaseID:FBgn0052687 Length:377 Species:Drosophila melanogaster


Alignment Length:346 Identity:92/346 - (26%)
Similarity:141/346 - (40%) Gaps:74/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 NLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYL 194
            :|.::.|.|...:...|...|...:|::.|..|.|..||..:.|...||.|||..|.|..||..:
  Fly    25 SLDLVTLEDHLASPQKALLKSSGDIETMLLNHNRLVGLPRLLLQFGNLKILDLSSNAITTLPDAV 89

  Fly   195 GYLPGLHELWLDHNQLQRLPPELGLLTK-----------------LTYLDVSENRLEELPNEISG 242
            ..|| |..|...:|.|........||||                 |..|::|.|:|...|.:::.
  Fly    90 CQLP-LVTLIAKNNLLTNASLPKSLLTKMANGNGNGNATGGTNSTLKELNLSGNQLTHFPEQVTE 153

  Fly   243 LVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPA 307
            |..|..|.|..|.:.::...|.|:..|.:|.|..|.:..:.:.:|:...:|.|:|.:|.:..||.
  Fly   154 LRHLKYLYLGGNKISSVSKDIWKMQSLHVLSLGGNLISEVPEAVGSLNQLQALVLCDNLIEILPT 218

  Fly   308 SIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKL--------KKLPPELGNCTVLHVL 364
            ||.::..|.:|.:.:|.|.:||.:|....||..||||||.|        ...||.|        |
  Fly   219 SIARLKNLKSLLLHKNRLRHLPKDIVALKNLTELSLRDNPLVVRFVQDMALKPPTL--------L 275

  Fly   365 DVSGNQLLYL-----PYSL--------------VNLQLKAVWLSENQSQ-------------PLL 397
            :::|..:...     ||.:              ||...|.|:. :|:.:             |||
  Fly   276 ELAGRMVKASGQRPGPYDIPRTLAEYLNSANCCVNPNCKGVFF-DNRVEHIKFVDFCGKYRVPLL 339

  Fly   398 TF-------QPDTDAETGEQV 411
            .:       :|:..|..|..|
  Fly   340 QYLCSSKCIEPEQPAARGSSV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 48/169 (28%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380
LRR_8 84..138 CDD:290566 2/7 (29%)
leucine-rich repeat 85..107 CDD:275380
leucine-rich repeat 108..130 CDD:275380 92/346 (27%)
LRR_8 129..187 CDD:290566 18/56 (32%)
leucine-rich repeat 131..153 CDD:275380 5/21 (24%)
leucine-rich repeat 154..176 CDD:275380 7/21 (33%)
leucine-rich repeat 177..199 CDD:275380 10/21 (48%)
LRR_8 198..256 CDD:290566 20/74 (27%)
leucine-rich repeat 200..222 CDD:275380 6/21 (29%)
leucine-rich repeat 223..245 CDD:275380 7/21 (33%)
LRR_8 267..325 CDD:290566 16/57 (28%)
leucine-rich repeat 269..289 CDD:275380 5/19 (26%)
leucine-rich repeat 292..314 CDD:275380 8/21 (38%)
leucine-rich repeat 315..337 CDD:275380 7/21 (33%)
LRR_4 337..375 CDD:289563 14/50 (28%)
leucine-rich repeat 361..382 CDD:275380 6/39 (15%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
CG32687NP_001259412.1 leucine-rich repeat 72..92 CDD:275380 9/19 (47%)
leucine-rich repeat 94..133 CDD:275380 8/38 (21%)
LRR_8 132..190 CDD:290566 17/57 (30%)
LRR_4 134..171 CDD:289563 11/36 (31%)
leucine-rich repeat 134..156 CDD:275380 7/21 (33%)
leucine-rich repeat 157..179 CDD:275380 6/21 (29%)
leucine-rich repeat 180..202 CDD:275380 5/21 (24%)
LRR_8 202..259 CDD:290566 23/56 (41%)
leucine-rich repeat 203..225 CDD:275380 8/21 (38%)
leucine-rich repeat 226..248 CDD:275380 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.