| Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_004479.1 | Gene: | GP5 / 2814 | HGNCID: | 4443 | Length: | 560 | Species: | Homo sapiens |
| Alignment Length: | 346 | Identity: | 112/346 - (32%) |
|---|---|---|---|
| Similarity: | 168/346 - (48%) | Gaps: | 31/346 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 LPQVPEEILRYSRTLEELFLDANHIRDLPKNFF-RLHRLRKLGLSDNEIGRLPPDI-QNFENLVE 87
Fly 88 LDVSRNDIPDIPDDIKHLQS-LQVADFSSNPIPKLPSG-FSQLKNLTVLGLNDMSLTTL-PADFG 149
Fly 150 SLTQLESLELRENLLKHLPETI-SQLTKLKRLDLGDNEIEDLPPYL-GYLPGLHELWLDHNQLQR 212
Fly 213 LP-PELGLLTKLTYLDVS-ENRLEELP-NEISGLVSLTDLDLAQNLLEALPDGIAK-LSRLTILK 273
Fly 274 LDQNRLQRLNDTL-GNCENMQELILTENFLSELPASI-GQMTKLNNLNVDRNA----------LE 326
Fly 327 YLPLEIG--------QCANLG 339 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| scrib | NP_001163746.1 | LRR_RI | 13..283 | CDD:238064 | 95/268 (35%) |
| leucine-rich repeat | 18..38 | CDD:275380 | 2/12 (17%) | ||
| LRR_8 | 37..95 | CDD:290566 | 25/59 (42%) | ||
| leucine-rich repeat | 39..61 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 62..84 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 84..138 | CDD:290566 | 18/55 (33%) | ||
| leucine-rich repeat | 85..107 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 108..130 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 129..187 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 131..153 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 154..176 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 177..199 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 198..256 | CDD:290566 | 25/60 (42%) | ||
| leucine-rich repeat | 200..222 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 223..245 | CDD:275380 | 10/23 (43%) | ||
| LRR_8 | 267..325 | CDD:290566 | 16/69 (23%) | ||
| leucine-rich repeat | 269..289 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 292..314 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 315..337 | CDD:275380 | 6/39 (15%) | ||
| LRR_4 | 337..375 | CDD:289563 | 1/3 (33%) | ||
| leucine-rich repeat | 361..382 | CDD:275380 | |||
| PDZ | 728..816 | CDD:214570 | |||
| PDZ_signaling | 931..1016 | CDD:238492 | |||
| PDZ | 1239..1329 | CDD:214570 | |||
| PDZ_signaling | 1336..1425 | CDD:238492 | |||
| GP5 | NP_004479.1 | LRR 1 | 75..96 | ||
| LRR_RI | <76..230 | CDD:238064 | 39/119 (33%) | ||
| LRR_8 | 76..134 | CDD:290566 | 9/23 (39%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | |||
| LRR 2 | 99..120 | 2/9 (22%) | |||
| leucine-rich repeat | 100..123 | CDD:275380 | 2/12 (17%) | ||
| LRR 3 | 123..144 | 10/20 (50%) | |||
| leucine-rich repeat | 124..147 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 147..206 | CDD:290566 | 19/58 (33%) | ||
| LRR 4 | 147..168 | 6/20 (30%) | |||
| leucine-rich repeat | 148..171 | CDD:275380 | 7/22 (32%) | ||
| LRR_RI | 163..400 | CDD:238064 | 81/236 (34%) | ||
| LRR 5 | 171..193 | 7/21 (33%) | |||
| leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 195..254 | CDD:290566 | 18/58 (31%) | ||
| LRR 6 | 195..216 | 6/20 (30%) | |||
| leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
| LRR 7 | 219..240 | 5/20 (25%) | |||
| leucine-rich repeat | 220..243 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 242..302 | CDD:290566 | 22/59 (37%) | ||
| LRR 8 | 243..264 | 8/20 (40%) | |||
| leucine-rich repeat | 244..267 | CDD:275380 | 8/22 (36%) | ||
| LRR 9 | 267..288 | 7/20 (35%) | |||
| leucine-rich repeat | 268..291 | CDD:275380 | 8/22 (36%) | ||
| LRR 10 | 291..312 | 10/20 (50%) | |||
| leucine-rich repeat | 292..315 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 314..375 | CDD:290566 | 24/60 (40%) | ||
| leucine-rich repeat | 316..338 | CDD:275380 | 8/21 (38%) | ||
| LRR 11 | 340..361 | 10/20 (50%) | |||
| leucine-rich repeat | 341..364 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 364..421 | CDD:290566 | 15/56 (27%) | ||
| LRR 12 | 364..385 | 7/20 (35%) | |||
| leucine-rich repeat | 365..388 | CDD:275380 | 8/22 (36%) | ||
| LRR 13 | 388..409 | 5/20 (25%) | |||
| leucine-rich repeat | 389..410 | CDD:275380 | 6/20 (30%) | ||
| LRRCT | 421..472 | CDD:214507 | 7/35 (20%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 469..498 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||