| Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_694992.2 | Gene: | LRRC57 / 255252 | HGNCID: | 26719 | Length: | 239 | Species: | Homo sapiens |
| Alignment Length: | 224 | Identity: | 72/224 - (32%) |
|---|---|---|---|
| Similarity: | 112/224 - (50%) | Gaps: | 28/224 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 133 VLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYL-GY 196
Fly 197 LPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPD 261
Fly 262 GIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALE 326
Fly 327 --YLPLEIGQCANLGVLSLRDN--KLKKL 351 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| scrib | NP_001163746.1 | LRR_RI | 13..283 | CDD:238064 | 51/150 (34%) |
| leucine-rich repeat | 18..38 | CDD:275380 | |||
| LRR_8 | 37..95 | CDD:290566 | |||
| leucine-rich repeat | 39..61 | CDD:275380 | |||
| leucine-rich repeat | 62..84 | CDD:275380 | |||
| LRR_8 | 84..138 | CDD:290566 | 2/4 (50%) | ||
| leucine-rich repeat | 85..107 | CDD:275380 | |||
| leucine-rich repeat | 108..130 | CDD:275380 | |||
| LRR_8 | 129..187 | CDD:290566 | 14/53 (26%) | ||
| leucine-rich repeat | 131..153 | CDD:275380 | 9/19 (47%) | ||
| leucine-rich repeat | 154..176 | CDD:275380 | 0/21 (0%) | ||
| leucine-rich repeat | 177..199 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 198..256 | CDD:290566 | 22/57 (39%) | ||
| leucine-rich repeat | 200..222 | CDD:275380 | 9/21 (43%) | ||
| leucine-rich repeat | 223..245 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 267..325 | CDD:290566 | 14/57 (25%) | ||
| leucine-rich repeat | 269..289 | CDD:275380 | 5/19 (26%) | ||
| leucine-rich repeat | 292..314 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 315..337 | CDD:275380 | 8/23 (35%) | ||
| LRR_4 | 337..375 | CDD:289563 | 5/17 (29%) | ||
| leucine-rich repeat | 361..382 | CDD:275380 | |||
| PDZ | 728..816 | CDD:214570 | |||
| PDZ_signaling | 931..1016 | CDD:238492 | |||
| PDZ | 1239..1329 | CDD:214570 | |||
| PDZ_signaling | 1336..1425 | CDD:238492 | |||
| LRRC57 | NP_694992.2 | PRK15370 | <21..>211 | CDD:185268 | 67/212 (32%) |
| LRR 1 | 39..60 | 10/20 (50%) | |||
| leucine-rich repeat | 40..63 | CDD:275380 | 11/22 (50%) | ||
| LRR 2 | 63..84 | 8/20 (40%) | |||
| leucine-rich repeat | 64..86 | CDD:275380 | 9/21 (43%) | ||
| LRR 3 | 86..107 | 8/20 (40%) | |||
| leucine-rich repeat | 87..109 | CDD:275380 | 8/21 (38%) | ||
| LRR 4 | 109..131 | 8/21 (38%) | |||
| leucine-rich repeat | 110..132 | CDD:275380 | 9/21 (43%) | ||
| LRR 5 | 132..153 | 5/20 (25%) | |||
| leucine-rich repeat | 133..154 | CDD:275380 | 5/20 (25%) | ||
| LRR 6 | 154..175 | 6/21 (29%) | |||
| leucine-rich repeat | 155..177 | CDD:275380 | 6/21 (29%) | ||
| LRR 7 | 177..197 | 7/19 (37%) | |||
| leucine-rich repeat | 178..199 | CDD:275380 | 8/20 (40%) | ||
| LRR 8 | 202..222 | 5/17 (29%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||