Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001127948.1 | Gene: | LRRC8B / 23507 | HGNCID: | 30692 | Length: | 803 | Species: | Homo sapiens |
Alignment Length: | 356 | Identity: | 116/356 - (32%) |
---|---|---|---|
Similarity: | 168/356 - (47%) | Gaps: | 40/356 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 EFVDKRHCSLPQVPEEILRYSRT----LEEL-FLDANHIRDLPKNFFRLHRLRKLGLSDNEIGRL 75
Fly 76 PPDIQNFENLVELDVSRNDIPDIP--------DDIKHLQSLQVADFSSNPIPK-----LPS---- 123
Fly 124 -------------GFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETIS--Q 173
Fly 174 LTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPN 238
Fly 239 EISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLS 303
Fly 304 ELPASIG--QMTKLNNLNVDRNALEYLPLEI 332 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scrib | NP_001163746.1 | LRR_RI | 13..283 | CDD:238064 | 97/303 (32%) |
leucine-rich repeat | 18..38 | CDD:275380 | 5/19 (26%) | ||
LRR_8 | 37..95 | CDD:290566 | 17/62 (27%) | ||
leucine-rich repeat | 39..61 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 62..84 | CDD:275380 | 6/21 (29%) | ||
LRR_8 | 84..138 | CDD:290566 | 20/83 (24%) | ||
leucine-rich repeat | 85..107 | CDD:275380 | 8/29 (28%) | ||
leucine-rich repeat | 108..130 | CDD:275380 | 7/43 (16%) | ||
LRR_8 | 129..187 | CDD:290566 | 24/59 (41%) | ||
leucine-rich repeat | 131..153 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 154..176 | CDD:275380 | 12/23 (52%) | ||
leucine-rich repeat | 177..199 | CDD:275380 | 8/21 (38%) | ||
LRR_8 | 198..256 | CDD:290566 | 25/57 (44%) | ||
leucine-rich repeat | 200..222 | CDD:275380 | 10/21 (48%) | ||
leucine-rich repeat | 223..245 | CDD:275380 | 11/21 (52%) | ||
LRR_8 | 267..325 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 269..289 | CDD:275380 | 7/19 (37%) | ||
leucine-rich repeat | 292..314 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 315..337 | CDD:275380 | 8/18 (44%) | ||
LRR_4 | 337..375 | CDD:289563 | |||
leucine-rich repeat | 361..382 | CDD:275380 | |||
PDZ | 728..816 | CDD:214570 | |||
PDZ_signaling | 931..1016 | CDD:238492 | |||
PDZ | 1239..1329 | CDD:214570 | |||
PDZ_signaling | 1336..1425 | CDD:238492 | |||
LRRC8B | NP_001127948.1 | Pannexin_like | 1..334 | CDD:315247 | |
PLN00113 | <428..>704 | CDD:215061 | 85/266 (32%) | ||
LRR 1 | 464..486 | 6/21 (29%) | |||
leucine-rich repeat | 465..488 | CDD:275380 | 6/22 (27%) | ||
LRR 2 | 488..509 | 6/20 (30%) | |||
leucine-rich repeat | 489..511 | CDD:275380 | 6/21 (29%) | ||
LRR 3 | 511..532 | 6/20 (30%) | |||
leucine-rich repeat | 512..539 | CDD:275380 | 6/26 (23%) | ||
LRR 4 | 539..559 | 5/20 (25%) | |||
leucine-rich repeat | 540..562 | CDD:275380 | 6/22 (27%) | ||
LRR 5 | 562..582 | 1/19 (5%) | |||
leucine-rich repeat | 563..609 | CDD:275380 | 8/45 (18%) | ||
LRR | <578..788 | CDD:227223 | 79/209 (38%) | ||
LRR 6 | 586..607 | 6/20 (30%) | |||
LRR 7 | 609..630 | 11/20 (55%) | |||
leucine-rich repeat | 610..634 | CDD:275380 | 12/23 (52%) | ||
LRR 8 | 634..655 | 7/20 (35%) | |||
leucine-rich repeat | 635..657 | CDD:275380 | 8/21 (38%) | ||
LRR 9 | 657..678 | 9/20 (45%) | |||
leucine-rich repeat | 658..680 | CDD:275380 | 10/21 (48%) | ||
LRR 10 | 680..701 | 11/20 (55%) | |||
leucine-rich repeat | 681..703 | CDD:275380 | 11/21 (52%) | ||
LRR 11 | 703..724 | 7/20 (35%) | |||
leucine-rich repeat | 704..726 | CDD:275380 | 7/21 (33%) | ||
LRR 12 | 726..747 | 7/20 (35%) | |||
leucine-rich repeat | 727..749 | CDD:275380 | 7/21 (33%) | ||
LRR 13 | 749..771 | 7/21 (33%) | |||
leucine-rich repeat | 750..772 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 773..796 | CDD:275380 | 9/20 (45%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |