DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and ZK546.2

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_740983.2 Gene:ZK546.2 / 173855 WormBaseID:WBGene00022759 Length:485 Species:Caenorhabditis elegans


Alignment Length:449 Identity:115/449 - (25%)
Similarity:176/449 - (39%) Gaps:149/449 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 TLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDH 207
            |:.|...:.::...|.|:|:.|..:|:.:..||.||.||:..|.:..|||::|.:..|..|.|..
 Worm     9 TVRARLANASKTRVLSLKESALHRIPDDVKDLTMLKHLDMSINYLTQLPPFIGSMSHLKNLNLSR 73

  Fly   208 NQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLD---------------------- 250
            |||:.||.|:..|..|..|:||:|:|.||| ::|..|||..::                      
 Worm    74 NQLESLPLEINSLACLEVLNVSQNKLTELP-DLSQCVSLKTVEAIENQFIIFPAGVCKCPNLETC 137

  Fly   251 -LAQNLLEALPDGIAKLSRLTILKLDQNRLQRLND-TLGNCE----------------------- 290
             |.:|.:|.|||.|..|..:::: |::|||..||. .|..||                       
 Worm   138 LLTENRIEKLPDEIHSLRAISVI-LNKNRLLSLNTANLLRCERLRAVNVDDNQLNRDEIEQFLVN 201

  Fly   291 -------------------NMQE------------------------------------------ 294
                               ::||                                          
 Worm   202 APREIRISFERNVSQMHTTDLQEMGNDSSKTKSIGDNARKIIGKSGPSTSTVNKHLEMASKSRIL 266

  Fly   295 -----------------------LILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCA 336
                                   |.|:||.:.|:|..|||.::|..|::..|.||:||.|:|...
 Worm   267 QLKGTGLKKVPDEIEPLADVLRNLELSENKIREIPIFIGQFSQLKQLHLANNCLEFLPDELGSMK 331

  Fly   337 NLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVN-LQLKAVWLSENQSQPLLTFQ 400
            .|.:|:|..||||.||..:..||.|..:|:|.|.....|.:::. |||..:.|:.||.:.|    
 Worm   332 KLEILNLAGNKLKALPDTIVGCTDLKTIDLSSNVFTVFPVAVIGCLQLDILNLNGNQIESL---- 392

  Fly   401 PDTDAETGEQVLSCYLLPQQEYQPITPA--------RDLESDSEPFEEREPSRTVVKFS 451
            ||..:......||   |.|.....:.|:        |.|..|....|:.|.:|.:::.|
 Worm   393 PDDISNLKVIELS---LNQNRLSSLNPSNLAKTTRLRTLRLDENCLEKSEFTRDLLESS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 53/162 (33%)
leucine-rich repeat 18..38 CDD:275380
LRR_8 37..95 CDD:290566
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..84 CDD:275380
LRR_8 84..138 CDD:290566
leucine-rich repeat 85..107 CDD:275380
leucine-rich repeat 108..130 CDD:275380
LRR_8 129..187 CDD:290566 14/43 (33%)
leucine-rich repeat 131..153 CDD:275380 2/9 (22%)
leucine-rich repeat 154..176 CDD:275380 6/21 (29%)
leucine-rich repeat 177..199 CDD:275380 9/21 (43%)
LRR_8 198..256 CDD:290566 25/80 (31%)
leucine-rich repeat 200..222 CDD:275380 10/21 (48%)
leucine-rich repeat 223..245 CDD:275380 10/21 (48%)
LRR_8 267..325 CDD:290566 23/165 (14%)
leucine-rich repeat 269..289 CDD:275380 7/20 (35%)
leucine-rich repeat 292..314 CDD:275380 11/86 (13%)
leucine-rich repeat 315..337 CDD:275380 9/21 (43%)
LRR_4 337..375 CDD:289563 15/37 (41%)
leucine-rich repeat 361..382 CDD:275380 5/21 (24%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
ZK546.2NP_740983.2 leucine-rich repeat 20..42 CDD:275380 6/21 (29%)
LRR_8 43..99 CDD:290566 24/55 (44%)
leucine-rich repeat 43..65 CDD:275380 9/21 (43%)
LRR_4 65..107 CDD:289563 19/42 (45%)
leucine-rich repeat 66..88 CDD:275380 10/21 (48%)
leucine-rich repeat 89..110 CDD:275380 10/21 (48%)
leucine-rich repeat 111..133 CDD:275380 1/21 (5%)
leucine-rich repeat 154..179 CDD:275380 9/25 (36%)
LRR_RI 208..460 CDD:238064 57/248 (23%)
leucine-rich repeat 264..286 CDD:275380 0/21 (0%)
leucine-rich repeat 287..309 CDD:275380 9/21 (43%)
LRR_8 308..364 CDD:290566 23/55 (42%)
leucine-rich repeat 310..332 CDD:275380 9/21 (43%)
leucine-rich repeat 333..355 CDD:275380 10/21 (48%)
leucine-rich repeat 356..378 CDD:275380 5/21 (24%)
LRR_8 378..433 CDD:290566 16/61 (26%)
leucine-rich repeat 379..398 CDD:275380 7/22 (32%)
leucine-rich repeat 399..424 CDD:275380 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.