| Sequence 1: | NP_001163746.1 | Gene: | scrib / 44448 | FlyBaseID: | FBgn0263289 | Length: | 2585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001243314.1 | Gene: | LRRC39 / 127495 | HGNCID: | 28228 | Length: | 339 | Species: | Homo sapiens |
| Alignment Length: | 286 | Identity: | 87/286 - (30%) |
|---|---|---|---|
| Similarity: | 141/286 - (49%) | Gaps: | 17/286 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 118 IPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDL 182
Fly 183 GDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENR-LEELPNEISGLVSL 246
Fly 247 TDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQ 311
Fly 312 MTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLK---KLPPELGNCTVLHVLDVSGNQLLY 373
Fly 374 LPYSLVNLQLKAVWLSENQSQPLLTF 399 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| scrib | NP_001163746.1 | LRR_RI | 13..283 | CDD:238064 | 52/165 (32%) |
| leucine-rich repeat | 18..38 | CDD:275380 | |||
| LRR_8 | 37..95 | CDD:290566 | |||
| leucine-rich repeat | 39..61 | CDD:275380 | |||
| leucine-rich repeat | 62..84 | CDD:275380 | |||
| LRR_8 | 84..138 | CDD:290566 | 3/19 (16%) | ||
| leucine-rich repeat | 85..107 | CDD:275380 | |||
| leucine-rich repeat | 108..130 | CDD:275380 | 2/11 (18%) | ||
| LRR_8 | 129..187 | CDD:290566 | 17/57 (30%) | ||
| leucine-rich repeat | 131..153 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 154..176 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 177..199 | CDD:275380 | 10/21 (48%) | ||
| LRR_8 | 198..256 | CDD:290566 | 23/58 (40%) | ||
| leucine-rich repeat | 200..222 | CDD:275380 | 8/21 (38%) | ||
| leucine-rich repeat | 223..245 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 267..325 | CDD:290566 | 18/57 (32%) | ||
| leucine-rich repeat | 269..289 | CDD:275380 | 7/19 (37%) | ||
| leucine-rich repeat | 292..314 | CDD:275380 | 7/21 (33%) | ||
| leucine-rich repeat | 315..337 | CDD:275380 | 5/21 (24%) | ||
| LRR_4 | 337..375 | CDD:289563 | 13/40 (33%) | ||
| leucine-rich repeat | 361..382 | CDD:275380 | 2/20 (10%) | ||
| PDZ | 728..816 | CDD:214570 | |||
| PDZ_signaling | 931..1016 | CDD:238492 | |||
| PDZ | 1239..1329 | CDD:214570 | |||
| PDZ_signaling | 1336..1425 | CDD:238492 | |||
| LRRC39 | NP_001243314.1 | LRR_RI | 79..>263 | CDD:238064 | 62/183 (34%) |
| LRR_8 | 84..141 | CDD:290566 | 22/56 (39%) | ||
| LRR 1 | 84..105 | 7/20 (35%) | |||
| leucine-rich repeat | 85..107 | CDD:275380 | 6/21 (29%) | ||
| LRR 2 | 107..128 | 9/20 (45%) | |||
| leucine-rich repeat | 108..127 | CDD:275380 | 8/18 (44%) | ||
| LRR_8 | 129..188 | CDD:290566 | 23/58 (40%) | ||
| LRR 3 | 130..151 | 8/20 (40%) | |||
| leucine-rich repeat | 131..153 | CDD:275380 | 8/21 (38%) | ||
| LRR 4 | 153..176 | 8/22 (36%) | |||
| leucine-rich repeat | 154..177 | CDD:275380 | 9/22 (41%) | ||
| LRR 5 | 177..197 | 7/19 (37%) | |||
| leucine-rich repeat | 178..200 | CDD:275380 | 7/21 (33%) | ||
| LRR 6 | 200..221 | 7/20 (35%) | |||
| leucine-rich repeat | 201..223 | CDD:275380 | 7/21 (33%) | ||
| LRR_8 | 223..280 | CDD:290566 | 19/56 (34%) | ||
| LRR 7 | 223..244 | 7/20 (35%) | |||
| leucine-rich repeat | 224..246 | CDD:275380 | 7/21 (33%) | ||
| LRR 8 | 246..267 | 5/20 (25%) | |||
| leucine-rich repeat | 247..269 | CDD:275380 | 5/21 (24%) | ||
| LRR 9 | 269..290 | 10/20 (50%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||