DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and lrg1

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:XP_004911101.1 Gene:lrg1 / 116406453 XenbaseID:XB-GENE-984373 Length:372 Species:Xenopus tropicalis


Alignment Length:422 Identity:112/422 - (26%)
Similarity:172/422 - (40%) Gaps:114/422 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRK---------------LGLSDNEIGRL 75
            |..|..||.....|::..|......:..|:   :||...               |||:|      
 Frog     4 PSSPLLILTMGHQLKQDLLTITRSSNTAKS---IHRHNSGMSFIFVVVIFIPSALGLTD------ 59

  Fly    76 P-PDIQNFENLVELDV---SRNDIPDIPDDIK-HLQSLQVADFSSNPIPKLPSG-FSQLKNLTVL 134
            | |.:.|..:.:.:.|   || ::...|.... |..|:.| :|::  |..|.:| ||:|.||..|
 Frog    60 PCPSLCNCTSSLNISVVCISR-ELDSFPCSFPLHTISISV-EFTN--ITSLCNGSFSELPNLQEL 120

  Fly   135 GLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGY-LP 198
            .|::.:|.:||..|                 .:|     |:.|..|||.:|.|:.:.|.|.. :|
 Frog   121 HLSNNALQSLPIQF-----------------FVP-----LSSLHTLDLTNNLIQSVTPTLFLDVP 163

  Fly   199 GLHELWLDHNQLQRL-PPELGLLTKLTYLDVSENRLEELPN-EISGLVSLTDLDLAQNLLEALPD 261
            .|..|.|..|.|.:| ..::.:|..|.:||:|.|.|:|:.: ..|.|.:|.:|||:.|.|..||.
 Frog   164 ALRFLVLRGNLLTKLWISKISILKNLNWLDLSHNHLKEVNSMSFSSLNNLENLDLSYNQLHQLPS 228

  Fly   262 GIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTK-LNNLNVDRNAL 325
            .:.|...|         |||||             |..|.||.||:.....|. |.::.:.||:|
 Frog   229 SLLKGLPL---------LQRLN-------------LEGNNLSSLPSDFFAATPFLKHVFLARNSL 271

  Fly   326 EYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNLQLKAVWLSE 390
            .:||..:    .|.|:||:                  .||:|.|.|..||...:   |::..|::
 Frog   272 HFLPKGL----LLPVMSLK------------------TLDLSENMLKSLPSGFL---LESKGLND 311

  Fly   391 NQSQPLLTFQPDTDAETGEQVLSCYLLPQQEY 422
            :..|.|       |.........|:||...::
 Frog   312 SMEQTL-------DLSNNPWHCDCHLLSLHQW 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 78/280 (28%)
leucine-rich repeat 18..38 CDD:275380 4/11 (36%)
LRR_8 37..95 CDD:290566 15/76 (20%)
leucine-rich repeat 39..61 CDD:275380 3/21 (14%)
leucine-rich repeat 62..84 CDD:275380 7/37 (19%)
LRR_8 84..138 CDD:290566 18/58 (31%)
leucine-rich repeat 85..107 CDD:275380 5/25 (20%)
leucine-rich repeat 108..130 CDD:275380 8/22 (36%)
LRR_8 129..187 CDD:290566 15/57 (26%)
leucine-rich repeat 131..153 CDD:275380 7/21 (33%)
leucine-rich repeat 154..176 CDD:275380 2/21 (10%)
leucine-rich repeat 177..199 CDD:275380 8/22 (36%)
LRR_8 198..256 CDD:290566 22/59 (37%)
leucine-rich repeat 200..222 CDD:275380 7/22 (32%)
leucine-rich repeat 223..245 CDD:275380 9/22 (41%)
LRR_8 267..325 CDD:290566 16/58 (28%)
leucine-rich repeat 269..289 CDD:275380 6/19 (32%)
leucine-rich repeat 292..314 CDD:275380 6/21 (29%)
leucine-rich repeat 315..337 CDD:275380 6/21 (29%)
LRR_4 337..375 CDD:289563 9/37 (24%)
leucine-rich repeat 361..382 CDD:275380 7/20 (35%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
lrg1XP_004911101.1 LRR_RI 115..322 CDD:238064 79/282 (28%)
LRR_8 115..175 CDD:290566 23/81 (28%)
leucine-rich repeat 117..140 CDD:275380 9/44 (20%)
leucine-rich repeat 141..164 CDD:275380 8/22 (36%)
leucine-rich repeat 165..188 CDD:275380 7/22 (32%)
LRR_8 187..247 CDD:290566 26/81 (32%)
leucine-rich repeat 189..212 CDD:275380 9/22 (41%)
leucine-rich repeat 213..236 CDD:275380 9/22 (41%)
LRR_8 235..295 CDD:290566 27/103 (26%)
leucine-rich repeat 237..260 CDD:275380 12/35 (34%)
leucine-rich repeat 261..284 CDD:275380 8/26 (31%)
LRRCT 322..372 CDD:214507 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.