DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment scrib and LOC110438948

DIOPT Version :9

Sequence 1:	NP_001163746.1	Gene:	scrib / 44448	FlyBaseID:	FBgn0263289	Length:	2585	Species:	Drosophila melanogaster
Sequence 2:	XP_021328308.1	Gene:	LOC110438948 / 110438948	-ID:	-	Length:	360	Species:	Danio rerio

Alignment Length:	205	Identity:	49/205 - (23%)
Similarity:	76/205 - (37%)	Gaps:	64/205 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   667 SLSGKVTSPIEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAE---ASTDPDNLDGVTELRLE 728
            ||...:||.|       |...|:..::....:|::..|....|.:   |.....||||      |
Zfish   166 SLKNTITSGI-------VSSAQRGSKELGLSNSNMDYIQTDATIDFGNAGGPLINLDG------E 217

  Fly   729 QYEIHIERTAAGLGLSIA-------------------GGKGS------------TP--------- 753
            ...|:..:..||:..:|.                   |..||            ||
Zfish   218 VIGINTMKVTAGISFAIPSDRVRLFLDRSADKQKSWFGESGSKRRYIGVMMLILTPSIIEELRMR 282

  Fly   754 ---FKGDDDGIFISRVTEAGPADLAGLKVGDKVIKVNGIVV-VDADHYQAVQVLKACGAVLVLVV 814
               |.....|:.|.||....||:.||:|.|..:|::||:.| :..:.|.||:..::    |.:||
Zfish   283 DPSFPDVSHGVLIHRVIVGSPANRAGMKPGHVIIEINGVKVNMSEEIYNAVRTSES----LNVVV 343

  Fly   815 QREVTRLIGH 824
            :|....|:.|
Zfish   344 RRGADLLMLH 353

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
scrib	NP_001163746.1	LRR_RI	13..283	CDD:238064
		leucine-rich repeat	18..38	CDD:275380
		LRR_8	37..95	CDD:290566
		leucine-rich repeat	39..61	CDD:275380
		leucine-rich repeat	62..84	CDD:275380
		LRR_8	84..138	CDD:290566
		leucine-rich repeat	85..107	CDD:275380
		leucine-rich repeat	108..130	CDD:275380
		LRR_8	129..187	CDD:290566
		leucine-rich repeat	131..153	CDD:275380
		leucine-rich repeat	154..176	CDD:275380
		leucine-rich repeat	177..199	CDD:275380
		LRR_8	198..256	CDD:290566
		leucine-rich repeat	200..222	CDD:275380
		leucine-rich repeat	223..245	CDD:275380
		LRR_8	267..325	CDD:290566
		leucine-rich repeat	269..289	CDD:275380
		leucine-rich repeat	292..314	CDD:275380
		leucine-rich repeat	315..337	CDD:275380
		LRR_4	337..375	CDD:289563
		leucine-rich repeat	361..382	CDD:275380
		PDZ	728..816	CDD:214570	31/131 (24%)
		PDZ_signaling	931..1016	CDD:238492
		PDZ	1239..1329	CDD:214570
		PDZ_signaling	1336..1425	CDD:238492
LOC110438948	XP_021328308.1	DegQ	84..>337	CDD:333159	43/183 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910