DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and Lrrc39

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:NP_001366558.1 Gene:Lrrc39 / 109245 MGIID:1924557 Length:355 Species:Mus musculus


Alignment Length:401 Identity:99/401 - (24%)
Similarity:167/401 - (41%) Gaps:118/401 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RQVEFVDK------RHCSLPQVPEEILRY-SRTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDN 70
            |:.||..|      ...||.::.|::.|. .|.:  |.::....:.||.:..:|::|::..|...
Mouse    31 REKEFQHKLVRIWEDRVSLTKLKEKVTREDGRVI--LRIEKEEWKTLPSSLLKLNQLQEWQLHRT 93

  Fly    71 EIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLG 135
            .:.::|..|..|::|:.||:|||.|.:||..|                                 
Mouse    94 GLLKIPEFIGRFQHLIVLDLSRNTISEIPRGI--------------------------------- 125

  Fly   136 LNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDN-EIEDLPPYLGYLPG 199
                         |.||:|:.|.|..|.:|.:|:.:|..|.|::|:|..| :|.|          
Mouse   126 -------------GLLTRLQELILSYNKIKTVPKELSNCTSLEKLELAVNRDISD---------- 167

  Fly   200 LHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIA 264
                         |||||..|.|||:||:|.|:...:|:.:..:.:|..||:..|.|:.|||.:.
Mouse   168 -------------LPPELSKLLKLTHLDLSMNQFTTIPHAVLDMPALEWLDMGSNSLQQLPDSLD 219

  Fly   265 KLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLP 329
            ::..|..|.|.:|.:..|.:|:.|.:|:..|:|:.|.|.::|..:.:||                
Mouse   220 RMRSLHTLWLQRNEITCLPETIKNMKNLGTLVLSNNKLQDIPGCMEEMT---------------- 268

  Fly   330 LEIGQCANLGVLSLRDNKLK---KLPPELGNCTVLHVLDVSGNQLLYLPYSLVNLQLKAVWLSEN 391
                   ||..::.|||.|:   .|||.         .:..|.:    ...|..||....::.|:
Mouse   269 -------NLRFVNFRDNPLRLEVTLPPS---------DNTDGEE----EQELFGLQFMHAYIQES 313

  Fly   392 QSQPLLTFQPD 402
            :...:...|||
Mouse   314 RRTGMRFEQPD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 71/277 (26%)
leucine-rich repeat 18..38 CDD:275380 5/26 (19%)
LRR_8 37..95 CDD:290566 16/57 (28%)
leucine-rich repeat 39..61 CDD:275380 4/21 (19%)
leucine-rich repeat 62..84 CDD:275380 5/21 (24%)
LRR_8 84..138 CDD:290566 10/53 (19%)
leucine-rich repeat 85..107 CDD:275380 10/21 (48%)
leucine-rich repeat 108..130 CDD:275380 0/21 (0%)
LRR_8 129..187 CDD:290566 15/58 (26%)
leucine-rich repeat 131..153 CDD:275380 2/21 (10%)
leucine-rich repeat 154..176 CDD:275380 7/21 (33%)
leucine-rich repeat 177..199 CDD:275380 6/22 (27%)
LRR_8 198..256 CDD:290566 18/57 (32%)
leucine-rich repeat 200..222 CDD:275380 6/21 (29%)
leucine-rich repeat 223..245 CDD:275380 7/21 (33%)
LRR_8 267..325 CDD:290566 15/57 (26%)
leucine-rich repeat 269..289 CDD:275380 6/19 (32%)
leucine-rich repeat 292..314 CDD:275380 6/21 (29%)
leucine-rich repeat 315..337 CDD:275380 0/21 (0%)
LRR_4 337..375 CDD:289563 10/40 (25%)
leucine-rich repeat 361..382 CDD:275380 2/20 (10%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
Lrrc39NP_001366558.1 LRR 19..>286 CDD:227223 88/348 (25%)
LRR 1 84..105 4/20 (20%)
leucine-rich repeat 85..107 CDD:275380 5/21 (24%)
LRR 2 107..128 11/66 (17%)
leucine-rich repeat 108..127 CDD:275380 10/64 (16%)
LRR 3 130..152 7/21 (33%)
leucine-rich repeat 131..153 CDD:275380 7/21 (33%)
LRR 4 153..176 11/45 (24%)
leucine-rich repeat 154..177 CDD:275380 12/45 (27%)
LRR 5 177..198 8/20 (40%)
leucine-rich repeat 178..200 CDD:275380 7/21 (33%)
LRR 6 200..221 8/20 (40%)
leucine-rich repeat 201..223 CDD:275380 8/21 (38%)
LRR 7 223..244 6/20 (30%)
leucine-rich repeat 224..246 CDD:275380 7/21 (33%)
LRR 8 246..267 6/20 (30%)
leucine-rich repeat 247..269 CDD:275380 7/44 (16%)
LRR 9 269..290 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.