DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scrib and lrrc63

DIOPT Version :9

Sequence 1:NP_001163746.1 Gene:scrib / 44448 FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster
Sequence 2:XP_004911893.1 Gene:lrrc63 / 101734566 XenbaseID:XB-GENE-22068658 Length:525 Species:Xenopus tropicalis


Alignment Length:415 Identity:101/415 - (24%)
Similarity:156/415 - (37%) Gaps:90/415 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LPQVPEEILRYSRTLEELFLDAN----------HIRDLPKN----FFRLH-RLRKLGLSD--NEI 72
            ||.:.|:..:.||..::  :|..          |..|||.|    ..|.| :....|||.  ...
 Frog    55 LPSLNEQRPKTSRNEDK--MDGQQKPTPAAALLHSHDLPSNPHNPVLRSHNQAEPSGLSSFPKRS 117

  Fly    73 GRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLN 137
            .:.||               ..||.:.            ||.|.| |..|...|.|...|||..|
 Frog   118 HKKPP---------------VKIPPLD------------DFYSEP-PSTPVTLSGLIRQTVLLPN 154

  Fly   138 DMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLP---G 199
               ..||.....|.|...::|  ..:.|.|.|..||||.:.....      |:|.....:|   .
 Frog   155 ---TGTLSKPVLSHTHYNNIE--NYIAKILNEKQSQLTSVLLSPW------DIPEVARRIPEQQR 208

  Fly   200 LHELWLDHNQL--QRLPPELGLLTKLTYL--------DVSENRLEELPNEISGLVSLTDLDLAQN 254
            :.||.|:.:.|  :::...:..|.:..|.        |..:.:|:::      |||.::..:.::
 Frog   209 ILELQLEMSSLGERKITGPVNQLVRSQYCQGSDPMYDDTGQGQLQQM------LVSRSNFAVLES 267

  Fly   255 L-------------LEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELP 306
            |             :..|||.....:.|..|.|..|.|:.....:...|:::.|.|..|.|.|:|
 Frog   268 LVHGGSILNLKAFFISKLPDLTPLYNTLVYLNLSFNDLRHFPKEVYKLEHLEVLKLRNNPLKEIP 332

  Fly   307 ASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQL 371
            ..|..:.||.:..:....|..||..:.|.:.|.||.:..|.:..:...:.|..||..|:|.||.|
 Frog   333 FGIHSLKKLRSFIMSFCLLSSLPEGLFQLSCLQVLDVSYNSISSISSNISNLRVLEFLNVEGNNL 397

  Fly   372 LYLPYSLVNLQLKAVWLSENQSQPL 396
            ..||...:.|||:.:.:..|...||
 Frog   398 PALPCGALKLQLRCLRVRNNAMHPL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 67/300 (22%)
leucine-rich repeat 18..38 CDD:275380 4/12 (33%)
LRR_8 37..95 CDD:290566 14/74 (19%)
leucine-rich repeat 39..61 CDD:275380 8/36 (22%)
leucine-rich repeat 62..84 CDD:275380 5/23 (22%)
LRR_8 84..138 CDD:290566 13/53 (25%)
leucine-rich repeat 85..107 CDD:275380 2/21 (10%)
leucine-rich repeat 108..130 CDD:275380 8/21 (38%)
LRR_8 129..187 CDD:290566 16/57 (28%)
leucine-rich repeat 131..153 CDD:275380 7/21 (33%)
leucine-rich repeat 154..176 CDD:275380 7/21 (33%)
leucine-rich repeat 177..199 CDD:275380 3/24 (13%)
LRR_8 198..256 CDD:290566 13/83 (16%)
leucine-rich repeat 200..222 CDD:275380 5/23 (22%)
leucine-rich repeat 223..245 CDD:275380 4/29 (14%)
LRR_8 267..325 CDD:290566 15/57 (26%)
leucine-rich repeat 269..289 CDD:275380 5/19 (26%)
leucine-rich repeat 292..314 CDD:275380 7/21 (33%)
leucine-rich repeat 315..337 CDD:275380 5/21 (24%)
LRR_4 337..375 CDD:289563 12/37 (32%)
leucine-rich repeat 361..382 CDD:275380 8/20 (40%)
PDZ 728..816 CDD:214570
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
lrrc63XP_004911893.1 LRR_8 294..351 CDD:290566 15/56 (27%)
leucine-rich repeat 295..317 CDD:275380 5/21 (24%)
leucine-rich repeat 318..340 CDD:275380 7/21 (33%)
leucine-rich repeat 341..363 CDD:275380 5/21 (24%)
leucine-rich repeat 364..386 CDD:275380 5/21 (24%)
leucine-rich repeat 387..408 CDD:275380 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.