DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and HOS1

DIOPT Version :9

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_015393.1 Gene:HOS1 / 856181 SGDID:S000006272 Length:470 Species:Saccharomyces cerevisiae


Alignment Length:478 Identity:128/478 - (26%)
Similarity:187/478 - (39%) Gaps:152/478 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QRLAVTHSLVMNYGL--HKKMKIYRPYKASAQDMLRFHSDEYIAYL------------------- 71
            |:..:|:||:..|.|  |....:..|| |...|:|.|||..||.||                   
Yeast    25 QKSQLTYSLINAYDLLQHFDEVLTFPY-ARKDDLLEFHSKSYIDYLINGRFNKMMAQDVNNPMVE 88

  Fly    72 -----------------------------------------QQVTPQNIQC--NSVAYTK----- 88
                                                     .|....|:.|  ||...|.     
Yeast    89 SKWSELSELADNWNEKIDYNPSQDLQRFTTRENLYNYYLNHSQALENNMDCINNSEVPTNDKPTD 153

  Fly    89 -YLAH-----FSVGEDCPVFDGLFDFCAMYTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEAS 147
             |:.:     :::..|||:|..|..:|.:.|||:|.....|:.....|.|||.||.|||.|..||
Yeast   154 TYILNSETKQYNLEGDCPIFSYLPMYCQVITGATLNLLDHLSPTERLIGINWDGGRHHAFKQRAS 218

  Fly   148 GFCYVNDIVIGILELLKYH-PRVLYIDIDVHHGDGVQEAFYLTDRVMTASFHKYGNYFFPGTGDM 211
            ||||:||:|:.|..|.|.. .::.|:|.|:||||||::||..:.::.|.|.|.|...||||||.:
Yeast   219 GFCYINDVVLLIQRLRKAKLNKITYVDFDLHHGDGVEKAFQYSKQIQTISVHLYEPGFFPGTGSL 283

  Fly   212 YEIGAESGRYYSVNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSL 276
            .:...:..   .||:|||.|.||.....:...|::.:::.:.|.|::::||.|.|.|||...:.|
Yeast   284 SDSRKDKN---VVNIPLKHGCDDNYLELIASKIVNPLIERHEPEALIIECGGDGLLGDRFNEWQL 345

  Fly   277 STKGHGECVKFVKELNV-------PTLVVGGGGYTLRNVARCWTHETSLLVDQDIENDLPATEYY 334
            :.:|....:     :|:       ...::|||||                      |||..:.:|
Yeast   346 TIRGLSRII-----INIMKSYPRAHIFLLGGGGY----------------------NDLLMSRFY 383

  Fly   335 DFFAPDFTLHPEINSRQDNANSKQYLELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRSNRE 399
                                   .||...|...:.||: |..:.|.|:  .|.||          
Yeast   384 -----------------------TYLTWCVTKQFSNLR-CGDNNSFQI--DPFDV---------- 412

  Fly   400 EASDPDVRISVADEDKLVDAKNE 422
              .|.|.......|..||:..||
Yeast   413 --CDGDDSEQFIREHDLVEMYNE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 119/442 (27%)
HOS1NP_015393.1 HDAC_Hos1 5..390 CDD:212543 112/418 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.