DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and HDA6

DIOPT Version :9

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_201116.1 Gene:HDA6 / 836431 AraportID:AT5G63110 Length:471 Species:Arabidopsis thaliana


Alignment Length:432 Identity:232/432 - (53%)
Similarity:308/432 - (71%) Gaps:17/432 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDMLRFHSDEYI 68
            |||||||...:|:::||.||||||.|:.:.|||:::|.||::::|.||..|.|.|:.||||.||:
plant    19 RRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHSLIIHYHLHRRLEISRPSLADASDIGRFHSPEYV 83

  Fly    69 AYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGAQKLNHNHSDICIN 133
            .:|..|:|:::...|.|  :.|..|:|||||||||||||||....|.|:..|.|||...:||.||
plant    84 DFLASVSPESMGDPSAA--RNLRRFNVGEDCPVFDGLFDFCRASAGGSIGAAVKLNRQDADIAIN 146

  Fly   134 WSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGDGVQEAFYLTDRVMTASFH 198
            |.||||||||.||||||||||||:|||||||...|||||||||||||||:||||.||||||.|||
plant   147 WGGGLHHAKKSEASGFCYVNDIVLGILELLKMFKRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFH 211

  Fly   199 KYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGA 263
            |:|: ||||||.:.::|||.|:||::||||.:|:||:|:..:|:|:|..:|:.|:|.|:||||||
plant   212 KFGD-FFPGTGHIRDVGAEKGKYYALNVPLNDGMDDESFRSLFRPLIQKVMEVYQPEAVVLQCGA 275

  Fly   264 DSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGGGGYTLRNVARCWTHETSLLVDQDIENDL 328
            |||:|||||||:||.|||.:|::|::..|||.:|:||||||:|||||||.:||::.|..:.:|.|
plant   276 DSLSGDRLGCFNLSVKGHADCLRFLRSYNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKL 340

  Fly   329 PATEYYDFFAPDFTLHPEINSRQDNANSKQYLELIVKHVYENLKMCQHSPSVQMVQTPP-DVDLE 392
            |..||:::|.||:|||.: .|..:|.|:.:.:|.|...:.|.|....|:||||...||| :..|:
plant   341 PYNEYFEYFGPDYTLHVD-PSPMENLNTPKDMERIRNTLLEQLSGLIHAPSVQFQHTPPVNRVLD 404

  Fly   393 ELRSNREEASDPDVRISVADEDKLVDAKNEFYDGD-QDQDKP 433
            |...:.|....|.:....|.           |:.| .|.|||
plant   405 EPEDDMETRPKPRIWSGTAT-----------YESDSDDDDKP 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 221/384 (58%)
HDA6NP_201116.1 HDAC_classI 24..331 CDD:212517 189/309 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100248
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.670

Return to query results.
Submit another query.