DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and AT5G61050

DIOPT Version :10

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_200913.1 Gene:AT5G61050 / 836226 AraportID:AT5G61050 Length:252 Species:Arabidopsis thaliana


Alignment Length:126 Identity:28/126 - (22%)
Similarity:43/126 - (34%) Gaps:38/126 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IAYLQQVTPQNIQCNSVAYTKYLAHF----------SVGEDCPVFDGLFDFCAMYTGASLEGAQK 122
            :||...:|..|.|.:...|...|..|          :|..|.|.||     .|....|..||:..
plant   112 VAYTNPLTNLNDQTHMCLYRITLEQFNDLLFQENELNVDSDYPFFD-----LAALRLAEKEGSIS 171

  Fly   123 LNHNHSD------ICINWSG---------GLHHAKKFEASGF-------CYVNDIVIGILE 161
            | ...||      :|:...|         .|...:||::...       .|.|.::.|:::
plant   172 L-QTASDSLYGNVVCLGKEGVIPILTLTCTLSVVEKFKSGEIPIRPPAKAYANTLIRGLVK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 28/126 (22%)
AT5G61050NP_200913.1 None

Return to query results.
Submit another query.