DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and hda10

DIOPT Version :9

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_190052.1 Gene:hda10 / 823592 AraportID:AT3G44660 Length:142 Species:Arabidopsis thaliana


Alignment Length:163 Identity:63/163 - (38%)
Similarity:88/163 - (53%) Gaps:30/163 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 FSLSTKGHGECVKFVKELNVPTLVVGGGGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFA 338
            ||:...||.||                ||||..|||||||.||.:|:|.::.|::|..:|..:||
plant     3 FSMLFTGHAEC----------------GGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFA 51

  Fly   339 PDFTL-----HPEINSRQDNANSKQYLELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRSNR 398
            |||:|     |.|      |.|:|.|:..|...:.|||:..||:|||||.:.|||..:.:.   .
plant    52 PDFSLKIPGGHIE------NLNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDF---D 107

  Fly   399 EEASDPDVRISVADEDKLVDAKNEFYDGDQDQD 431
            |:..:||||:.....||.:...:|::|||.|.|
plant   108 EDEQNPDVRVDQRSRDKQIQRDDEYFDGDNDND 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 48/118 (41%)
hda10NP_190052.1 Arginase_HDAC <3..100 CDD:302587 48/118 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.