DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and phka1a

DIOPT Version :9

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_005166576.1 Gene:phka1a / 572183 ZFINID:ZDB-GENE-031118-56 Length:1232 Species:Danio rerio


Alignment Length:85 Identity:23/85 - (27%)
Similarity:33/85 - (38%) Gaps:13/85 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 GYTLRNVARCWTHETSLLVDQDIENDLPAT-EYYDFFAPD----------FTLHPEINSRQDNAN 355
            |..|.|.||. .|:|.|.....:...|||: |..|.:..|          .:|....|:.:|...
Zfish     8 GVKLDNYARI-VHQTILRHQDPVTGLLPASKEQPDAWVRDNVYSILSVWALSLAYRKNADRDEDK 71

  Fly   356 SKQY-LELIVKHVYENLKMC 374
            :|.| ||..|..:...:..|
Zfish    72 AKAYELEQSVVKLMRGVLQC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 23/85 (27%)
phka1aXP_005166576.1 Glyco_hydro_15 8..>439 CDD:279112 23/85 (27%)
Glyco_hydro_15 <802..919 CDD:279112
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.