DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and hdac11

DIOPT Version :9

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_021335266.1 Gene:hdac11 / 431718 ZFINID:ZDB-GENE-040704-7 Length:375 Species:Danio rerio


Alignment Length:288 Identity:73/288 - (25%)
Similarity:108/288 - (37%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KASAQDMLRFHSDEY------------------IAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDC 99
            :||..|:|..|:..|                  :|.:.::.|.....|.:...|.|.....    
Zfish    76 EASEADLLVVHTARYLNRLKNAILEGSREWSLVVATITEIPPLLFLPNFLVQRKVLRPLRT---- 136

  Fly   100 PVFDGLFDFCAMYTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGI---LE 161
                        .||.::. |.||..:.. ..||..||.||....:..|||...||.:.|   .|
Zfish   137 ------------QTGGTIM-AGKLAIDRG-WAINVGGGFHHCSSDKGGGFCAYADITLAIKFLFE 187

  Fly   162 LLKYHPRVLYIDIDVHHGDGVQEAFYLTDR---VMTASFHKYGNYFFPGTGDMYEIGAESGRYYS 223
            .::.......||:|.|.|:| .|..:|.||   :|..    |..:.:||.|       .:.|...
Zfish   188 RVEGVASATIIDLDAHQGNG-HERDFLEDRRVYIMDV----YNRHIYPGDG-------YAKRAIK 240

  Fly   224 VNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKG---HGECV 285
            ..|.|..|.:|..|.|.........::..||..|:...|.|.|.||.||..::|.:|   ..|.:
Zfish   241 RKVELDWGTEDSEYLQKVDLHSEGALNEARPDIIIYNAGTDILDGDPLGGLAISPQGIIKRDEII 305

  Fly   286 -KFVKELNVPTLVVGGGGY---TLRNVA 309
             :..:...:|.|:|..|||   |.|.:|
Zfish   306 FRAARRRGIPILMVTSGGYQKKTARIIA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 73/288 (25%)
hdac11XP_021335266.1 HDAC_classIV 46..339 CDD:212519 73/288 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.