DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and HDAC11

DIOPT Version :9

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster


Alignment Length:290 Identity:72/290 - (24%)
Similarity:114/290 - (39%) Gaps:57/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LHKKM---------KIYRPYKASAQDMLRFHSDEYIAYLQQVTPQNIQC-----------NSVAY 86
            :||.:         ..|.|.:.:...:.|.|:.||:..|:  ...|:.|           |....
  Fly    61 IHKLLCAQLQLDDGSFYEPTELTKDQLRRIHTREYLKSLR--WSMNVACIAEVPLMAFVPNRYIQ 123

  Fly    87 TKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEASGFCY 151
            ..||....             |.|  .|:.|.|...|::..:   ||..||.||...:...|||.
  Fly   124 RSYLRPMR-------------FQA--AGSILAGKLALDYGWA---INLGGGFHHCCSYRGGGFCP 170

  Fly   152 VNDIVIGILELLKYHP----RVLYIDIDVHHGDGVQEAFYLTDRVMTASFHKYGNYFFPGTGDMY 212
            ..||.:.|:.|.:..|    |::.:|:|.|.|:|.:..|.....|..  |..|..:.:|..    
  Fly   171 YADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYI--FDMYNAFVYPRD---- 229

  Fly   213 EIGAESGRYYSVNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLS 277
            .:..||.|   ..|.|:...:|..|.:..|..:...:..:||..:|...|.|.|.||.||..::|
  Fly   230 HVAKESIR---CAVELRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEGDPLGNLAIS 291

  Fly   278 TKGHGECVKFV----KELNVPTLVVGGGGY 303
            .:|..|..:.|    :.|.:|.:::..|||
  Fly   292 AEGVIERDRLVFSTFRALGIPVVMLLSGGY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 72/290 (25%)
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 72/290 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.