DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and hdac8

DIOPT Version :9

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001120462.1 Gene:hdac8 / 100145561 XenbaseID:XB-GENE-5863426 Length:369 Species:Xenopus tropicalis


Alignment Length:353 Identity:150/353 - (42%)
Similarity:236/353 - (66%) Gaps:20/353 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDMLRFHSDEYIAYLQQVT-------PQNIQCNSV 84
            |:|.::.|||:..|||.|:|::.:|..||.::|..||:|.|:.:|.:|:       |:.::    
 Frog    27 PRRASMVHSLIEAYGLLKEMRVVKPKVASMEEMAAFHTDSYLQHLHKVSEEGDNDDPETLE---- 87

  Fly    85 AYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEASGF 149
                    :.:|.|||:.:|::|:.|...||:|..|::|....:.|.|||.||.|||||.|||||
 Frog    88 --------YGLGYDCPITEGIYDYAAAVGGATLTAAEQLMAGKTRIAINWPGGWHHAKKDEASGF 144

  Fly   150 CYVNDIVIGILELLKYHPRVLYIDIDVHHGDGVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEI 214
            ||:||.|:|||:|.:...||||:|:|:||||||::||..|.:|||.|.||:...|||||||:.:|
 Frog   145 CYLNDAVLGILKLREKFDRVLYVDMDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDI 209

  Fly   215 GAESGRYYSVNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTK 279
            |...||||||||||::||.|:.|:|:.:.::..:...:.|.|:|||.|||::|||.:..|:::.:
 Frog   210 GLGKGRYYSVNVPLQDGIQDEKYYQICEGVLKEVFTTFNPEAVVLQLGADTIAGDPMCSFNMTPQ 274

  Fly   280 GHGECVKFVKELNVPTLVVGGGGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLH 344
            |.|:|:|:|.:..:|||::|||||.|.|.|||||:.|:|:|.:.:.:::|..|::..:.||:.|.
 Frog   275 GIGKCLKYVLQWQLPTLILGGGGYHLPNTARCWTYLTALIVGRTLSSEIPDHEFFTEYGPDYVLE 339

  Fly   345 PEINSRQDNANSKQYLELIVKHVYENLK 372
            ...:.|.|. |..|.::.|::.:..:||
 Frog   340 VTPSCRPDR-NDSQKVQEILQSIKGHLK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 150/353 (42%)
hdac8NP_001120462.1 Histone deacetylase. /evidence=ECO:0000250 5..316 137/300 (46%)
HDAC8 7..369 CDD:212524 150/353 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.