DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC3 and HDAC6

DIOPT Version :9

Sequence 1:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001308154.1 Gene:HDAC6 / 10013 HGNCID:14064 Length:1229 Species:Homo sapiens


Alignment Length:349 Identity:86/349 - (24%)
Similarity:144/349 - (41%) Gaps:59/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVSYFYNADVGNFH---YGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDMLRFHSDE 66
            |....|:.::.| |   :.:.||..|||:......:...||..:.....|..|:..::|..||.|
Human   494 RTGLVYDQNMMN-HCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAE 557

  Fly    67 YIAYLQ--------------------QVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAM 111
            |:.:|:                    .:.|....|         |..:.|..|.:.:      |:
Human   558 YVGHLRATEKMKTRELHRESSNFDSIYICPSTFAC---------AQLATGAACRLVE------AV 607

  Fly   112 YTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGI--LELLKYHP-RVLYID 173
            .:|..|.||         ..:...|  |||::..|.|||:.|.:.:..  .:.:..|. |:|.:|
Human   608 LSGEVLNGA---------AVVRPPG--HHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVD 661

  Fly   174 IDVHHGDGVQEAFYLTDRVMTASFHKYGN-YFFP--GTGDMYEIGAESGRYYSVNVPLK-EGIDD 234
            .|||||:|.|..|.....|:..|.|:|.: .|||  ..|...:||..:|..::|||... ..:.|
Human   662 WDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGD 726

  Fly   235 QSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKEL-NVPTLVV 298
            ..|...:..::..|...:.|..:::..|.|:..||.||...:|.:|:......:..| :...:::
Human   727 ADYLAAWHRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILI 791

  Fly   299 GGGGYTLRNVARCWTHET-SLLVD 321
            ..|||.|.:::......| |||.|
Human   792 LEGGYNLTSISESMAACTRSLLGD 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 86/349 (25%)
HDAC6NP_001308154.1 HDAC6-dom1 113..449 CDD:212545
HDAC6-dom2 499..849 CDD:212527 85/344 (25%)
zf-UBP 1147..1209 CDD:280334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.