DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and ABHD17A

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_112490.3 Gene:ABHD17A / 81926 HGNCID:28756 Length:361 Species:Homo sapiens


Alignment Length:218 Identity:65/218 - (29%)
Similarity:100/218 - (45%) Gaps:26/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TLLYFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAAIDYLHTRH 174
            |:|:.||||.::|.......|:...||||:...:|.|||.|:|.|:||.|..|..||...|.||:
Human   164 TVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRY 228

  Fly   175 DLDHSQLILFGRSLGGAVVVDVAADTVYGQKLMCAIVENTFSSIPEMAVELVHPAVK------YI 233
            .:....:||:|:|:|....||:|:      :..||.|  ...|.....:.:..|..|      ..
Human   229 GISPDSIILYGQSIGTVPTVDLAS------RYECAAV--VLHSPLTSGMRVAFPDTKKTYCFDAF 285

  Fly   234 PNLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPGGSHNDTWI 298
            ||:         .|:.|.:.|.|.|.|..|.::......|||.:|...::.|. ..|..|||..:
Human   286 PNI---------EKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLW-VEGAGHNDIEL 340

  Fly   299 VDGYYQAIGGFLAELQQQPLLKA 321
            ...|.:.:..|::  |:.|..:|
Human   341 YSQYLERLRRFIS--QELPSQRA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 61/200 (31%)
Abhydrolase_5 110..294 CDD:289465 57/189 (30%)
ABHD17ANP_112490.3 Hydrolase_4 161..335 CDD:288960 57/188 (30%)
Abhydrolase_5 164..336 CDD:289465 57/189 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.