DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Abhd17c

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_598483.2 Gene:Abhd17c / 70178 MGIID:1917428 Length:320 Species:Mus musculus


Alignment Length:210 Identity:58/210 - (27%)
Similarity:98/210 - (46%) Gaps:28/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TLLYFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAAIDYLHTRH 174
            |||:.||||.::|.......|:...::||:...:|.|||:|:|.|:|:.|..|..||...|.||:
Mouse   125 TLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRY 189

  Fly   175 DLDHSQLILFGRSLGGAVVVDVAADTVYGQKLMCAIVENTFSSIPEMAVELVHPAVKYIPNLLFK 239
            .:....:||:|:|:|....||:|:      :..||.|             ::|..:.....:.|.
Mouse   190 GVSPENIILYGQSIGTVPTVDLAS------RYECAAV-------------ILHSPLMSGLRVAFP 235

  Fly   240 --------NKYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPGGSHNDT 296
                    :.:.|:.||.|.:.|.|.|.|..|.::......|:|.:|...::.|. ..|..|||.
Mouse   236 DTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLW-VEGAGHNDI 299

  Fly   297 WIVDGYYQAIGGFLA 311
            .:...|.:.:..|::
Mouse   300 ELYAQYLERLKQFIS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 57/202 (28%)
Abhydrolase_5 110..294 CDD:289465 53/191 (28%)
Abhd17cNP_598483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..75
FrsA <125..317 CDD:223999 58/210 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R134
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.