DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acot4

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001102910.1 Gene:Acot4 / 681337 RGDID:1596753 Length:421 Species:Rattus norvegicus


Alignment Length:236 Identity:52/236 - (22%)
Similarity:88/236 - (37%) Gaps:69/236 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MVEYR-----GYGLST---------GVPTERGLVTDARAAIDYLHTR--HDLDHSQ-----LILF 184
            ::|||     |:|.:|         .:|.|..::     .:||....  :.|.|.:     :.|.
  Rat   170 LLEYRASLLAGHGFATLALAFYGFEDLPKEFNVI-----EVDYFEEAVCYMLQHPKVKGPDIGLL 229

  Fly   185 GRSLGGAVVVDVAADTVYGQKLMCAIVENTFSS----------IPEMAVELVHPAVKY--IPNLL 237
            |.|||..|.: :.|..:.......:|..:.||.          ||.:..:|....|.:  |.:::
  Rat   230 GLSLGADVCL-IMASFLKNVSATVSINGSAFSGNRYIHYKQTMIPPLGHDLRRTKVAFSGILDIV 293

  Fly   238 -FKN------KYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKC--------GSEIKRLLE 287
             .:|      :..||..|.|...|.||::|..|:.    ....|||:.        |.|..:::.
  Rat   294 DIRNDAVGGCENPSMIPIEKAKGPILFVAGQDDHC----WRSELYTQIASERLQAHGKERPQIIS 354

  Fly   288 FPGGSHNDTWIVDGYYQAIGGFLAELQQQPLLKAPEKSNVW 328
            :||..|   :|...|:        .:....|.|...|:.||
  Rat   355 YPGTGH---YIEPPYF--------PMCPASLHKIVNKAVVW 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 47/211 (22%)
Abhydrolase_5 110..294 CDD:289465 44/200 (22%)
Acot4NP_001102910.1 Bile_Hydr_Trans 17..137 CDD:282610
BAAT_C 203..412 CDD:285986 44/203 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.