DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and ACOT6

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001352717.1 Gene:ACOT6 / 641372 HGNCID:33159 Length:421 Species:Homo sapiens


Alignment Length:211 Identity:47/211 - (22%)
Similarity:81/211 - (38%) Gaps:55/211 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 AIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAA--DTVYGQKLMCAIVENTFSS-------IPEM 221
            |:|::.....:....:.|.|.|.||.:.:.:|:  ..:....|:.|.|.||.:.       ||::
Human   211 AVDFMLQHPKVKGPSIALLGFSKGGDLCLSMASFLKGITATVLINACVANTVAPLHYKDMIIPKL 275

  Fly   222 AVELVHPAVKYI-----------PNLLFKNKYHSMSKIGKCSVPFLFISGLAD---------NLV 266
            ..:|  ..||..           .|.|.::.:.|:..:.|..||||||.|:.|         .:.
Human   276 VDDL--GKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIA 338

  Fly   267 PPRMMRALYTKCGSEIKRLLEFPGGSHNDTWIVDGYY--------QAIGGFLAELQQQPLLKAPE 323
            ..|:...     |.|..:::.:|...|    .:|..|        .|:.|.......:|  ||..
Human   339 SERLQAH-----GKERPQIICYPETGH----CIDPPYFPPSRASVHAVLGEAIFYGGEP--KAHS 392

  Fly   324 KSNV--WVELE---HK 334
            |:.|  |.:::   ||
Human   393 KAQVDAWQQIQTFFHK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 37/175 (21%)
Abhydrolase_5 110..294 CDD:289465 34/156 (22%)
ACOT6NP_001352717.1 Bile_Hydr_Trans 16..136 CDD:309767
BAAT_C 203..412 CDD:312395 47/211 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.