DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and acot17

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_998412.2 Gene:acot17 / 572757 ZFINID:ZDB-GENE-040426-2381 Length:438 Species:Danio rerio


Alignment Length:213 Identity:37/213 - (17%)
Similarity:68/213 - (31%) Gaps:85/213 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MVEYRGYGLSTGVPTERGLVTDARAAIDYLH---------------------TRHDL-DHSQLIL 183
            ::|||...|::     .|.   |..|::||.                     ..|.| ...::.:
Zfish   188 LIEYRSALLAS-----HGF---ASMALEYLSPEKLKMTEVDGTYFEKAYQILQNHPLVQKDKMAV 244

  Fly   184 FGRSLGGAVVVDVAADTVYGQ--KLMCAIVENTFSSIP-----------------EMAV----EL 225
            .|...|.|:.:.:   |.|.:  |..|.:..:...:||                 ::.|    .|
Zfish   245 LGLCFGSAITLTM---TAYSRVIKPQCCVCISGSHAIPVDKCLFEVFEDIKKLNGKIQVNEDNHL 306

  Fly   226 VH----------PAVKYIPNLLFKNKYHSMSKIGKCSVPFLFISGLAD----NLVPPRMMRALYT 276
            :|          ||:|.              .:|:...|.|.::|..|    .:.....|..:..
Zfish   307 IHRNTILPIPSDPALKV--------------DVGRIKCPLLLVNGTDDQNWATVESAEDMEMMMK 357

  Fly   277 KCGS-EIKRLLEFPGGSH 293
            |.|: ::..:|.:|...|
Zfish   358 KAGNRQLLTVLTYPDAGH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 37/213 (17%)
Abhydrolase_5 110..294 CDD:289465 37/213 (17%)
acot17NP_998412.2 Bile_Hydr_Trans 29..155 CDD:282610
BAAT_C 219..431 CDD:285986 28/174 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.