DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and BAAT

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001121082.1 Gene:BAAT / 570 HGNCID:932 Length:418 Species:Homo sapiens


Alignment Length:377 Identity:68/377 - (18%)
Similarity:105/377 - (27%) Gaps:161/377 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPKSRGVGVGVLAAFLLCFIFYYFYGGYMTLALFAGIILLIFYYAQDLLLYH--PDLPANSRIYI 70
            ||...|:..||:..|          ||...|..|...:|....:|...|.||  .|||..     
Human   153 LPPGEGLFPGVIDLF----------GGLGGLLEFRASLLASRGFASLALAYHNYEDLPRK----- 202

  Fly    71 PIPTMHNLPHITVSIKTPDDVTLHAFWVTQPEERSKSSPTLLYFHGNAGNMGHRMQNVWG----- 130
                    |.:|                           .|.||. .|.|...|...|:|     
Human   203 --------PEVT---------------------------DLEYFE-EAANFLLRHPKVFGSGVGV 231

  Fly   131 --IYHHLHCNVLMVEY----------RGYGLSTGVPTERGLVTDARAAIDYLHTRHDLDHSQLIL 183
              :...:...:.|..|          .|.....|:|           .:.:......|.||..::
Human   232 VSVCQGVQIGLSMAIYLKQVTATVLINGTNFPFGIP-----------QVYHGQIHQPLPHSAQLI 285

  Fly   184 FGRSLGGAVVVDVAADTVYGQKLMCAIVE--NTFSSIPEMAVELVHPAVKYIPNLLFKNKYHSMS 246
            ...:||                    ::|  .||.:....|.:.:.|                  
Human   286 STNALG--------------------LLELYRTFETTQVGASQYLFP------------------ 312

  Fly   247 KIGKCSVPFLFISGLADNLVPPRMMRALYTKCGSEIKR-------LLEFPGGSHNDTWIVDGYYQ 304
             |.:....||||.|..|..:   ..:|...:...::||       ||.:||..|    :::..|.
Human   313 -IEEAQGQFLFIVGEGDKTI---NSKAHAEQAIGQLKRHGKNNWTLLSYPGAGH----LIEPPYS 369

  Fly   305 AI-------------GGFLAELQQQPLLKAPEKSNVWVELE-----HKIIDV 338
            .:             ||       :.:..|..:.:.|.|::     |.|.||
Human   370 PLCCASTTHDLRLHWGG-------EVIPHAAAQEHAWKEIQRFLRKHLIPDV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 41/258 (16%)
Abhydrolase_5 110..294 CDD:289465 37/209 (18%)
BAATNP_001121082.1 Bile_Hydr_Trans 14..140 CDD:377407
BAAT_C 207..412 CDD:370148 45/269 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.